• Gene id: 85508

Gene Summary

• Gene Symbol: SCRT2   Gene   UCSC   Ensembl
• Aliases: ZNF898B
• Gene name: scratch family transcriptional repressor 2
• Alternate names: transcriptional repressor scratch 2, scratch 2 protein, scratch family zinc finger 2, scratch homolog 2, zinc finger protein,
• Gene location: 20p13 (675801: 661595)     Exons: 2     NC_000020.11

Protein Summary

• Protein general information: Q9NQ03  
  • Name: Transcriptional repressor scratch 2 (Scratch homolog 2 zinc finger protein)
  • Length: 307  
  • Mass: 32584
• Sequence:

  MPRSFLVKKIKGDGFQCSGVPAPTYHPLETAYVLPGARGPPGDNGYAPHRLPPSSYDADQKPGLELAPAEPAYPP
  AAPEEYSDPESPQSSLSARYFRGEAAVTDSYSMDAFFISDGRSRRRRGGGGGDAGGSGDAGGAGGRAGRAGAQAG
  GGHRHACAECGKTYATSSNLSRHKQTHRSLDSQLARKCPTCGKAYVSMPALAMHLLTHNLRHKCGVCGKAFSRPW
  LLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHYRCRQCDKSFALKSYLHKHCEAACAKAAEPPPP
  TPAGPAS

• Structural information:
  • Interpro: IPR029794  IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • STRING: ENSP00000246104
• Other Databases: GeneCards:  SCRT2  Malacards:  SCRT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:2001222	regulation of neuron migration	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0070888	E-box binding	ISS	molecular function
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	ISS	biological process
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	ISS	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:0000790	nuclear chromatin	ISS	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray