• Gene id: 8550

Gene Summary

• Gene Symbol: MAPKAPK5   Gene   UCSC   Ensembl
• Aliases: MAPKAP-K5, MK-5, MK5, PRAK
• Gene name: MAPK activated protein kinase 5
• Alternate names: MAP kinase-activated protein kinase 5, MAPKAP kinase 5, MAPKAPK-5, mitogen-activated protein kinase-activated protein kinase 5, p38-regulated/activated protein kinase,
• Gene location: 12q24.12-q24.13 (24047425: 24029335)     Exons: 4     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a tumor suppressor and member of the serine/threonine kinase family. In response to cellular stress and proinflammatory cytokines, this kinase is activated through its phosphorylation by MAP kinases including MAPK1/ERK,
• OMIM: 606723

Protein Summary

• Protein general information: Q8IW41  
  • Name: MAP kinase activated protein kinase 5 (MAPK activated protein kinase 5) (MAPKAP kinase 5) (MAPKAP K5) (MAPKAPK 5) (MK 5) (MK5) (EC 2.7.11.1) (p38 regulated/activated protein kinase) (PRAK)
  • Length: 473  
  • Mass: 54220
  • Tissue specificity: Expressed ubiquitously. {ECO
• Sequence:

  MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKARNEVRLHMMCATHPNI
  VQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALALRHCHLLNIAHRDLK
  PENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLW
  SLGVIIYVMLCGYPPFYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLD
  HPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPILRKRKLLGTKPKDSVY
  IHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKV
  DRLKLAEIVKQVIEEQTTSHESQ

• Structural information:
  • Protein Domains: (22..30-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR008271  
  • Prosite: PS50011 PS00108
  • STRING: ENSP00000449381
• Other Databases: GeneCards:  MAPKAPK5  Malacards:  MAPKAPK5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051019	mitogen-activated protein kinase binding	IBA	molecular function
GO:0046777	protein autophosphorylation	IBA	biological process
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0009931	calcium-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:0007265	Ras protein signal transduction	IBA	biological process
GO:0005516	calmodulin binding	IBA	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0032007	negative regulation of TOR signaling	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0090400	stress-induced premature senescence	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0007265	Ras protein signal transduction	IDA	biological process
GO:0006417	regulation of translation	IDA	biological process
GO:0002039	p53 binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0032007	negative regulation of TOR signaling	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004708	MAP kinase kinase activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:1904355	positive regulation of telomere capping	IMP	biological process
GO:0051973	positive regulation of telomerase activity	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0000165	MAPK cascade	IEA	biological process
GO:0000187	activation of MAPK activity	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq