• Gene id: 85480

Gene Summary

• Gene Symbol: TSLP   Gene   UCSC   Ensembl
• Gene name: thymic stromal lymphopoietin
• Alternate names: thymic stromal lymphopoietin,
• Gene location: 5q22.1 (111070079: 111078025)     Exons: 6     NC_000005.10
• Gene summary(Entrez): This gene encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attract
• OMIM: 607003

Protein Summary

• Protein general information: Q969D9  
  • Name: Thymic stromal lymphopoietin
  • Length: 159  
  • Mass: 18141
  • Tissue specificity: Isoform 1 is expressed in a number of tissues including heart, liver and prostate. Isoform 2 is the predominant form in keratinocytes of oral mucosa, skin and in salivary glands. It is secreted into saliva. {ECO
• Sequence:

  MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHC
  LTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRR
  FNRPLLKQQ

• Structural information:
  • Interpro: IPR029189  IPR038329  
  • PDB: 5J11 5J12 5J13
  • PDBsum: 5J11 5J12 5J13
  • STRING: ENSP00000339804
• Other Databases: GeneCards:  TSLP  Malacards:  TSLP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005125	cytokine activity	IBA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0038111	interleukin-7-mediated signaling pathway	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0001961	positive regulation of cytokine-mediated signaling pathway	IDA	biological process
GO:1904894	positive regulation of receptor signaling pathway via STAT	IDA	biological process
GO:0005125	cytokine activity	IDA	molecular function
GO:0032722	positive regulation of chemokine production	IDA	biological process
GO:0005576	extracellular region	IDA	cellular component
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0005576	extracellular region	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0071657	positive regulation of granulocyte colony-stimulating factor production	IMP	biological process
GO:0032733	positive regulation of interleukin-10 production	IMP	biological process
GO:0032755	positive regulation of interleukin-6 production	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0032736	positive regulation of interleukin-13 production	IMP	biological process
GO:0032754	positive regulation of interleukin-5 production	IMP	biological process
GO:0033005	positive regulation of mast cell activation	IMP	biological process
GO:0071654	positive regulation of chemokine (C-C motif) ligand 1 production	IMP	biological process
GO:0005125	cytokine activity	IMP	molecular function
GO:0050729	positive regulation of inflammatory response	IMP	biological process
GO:0005576	extracellular region	IMP	cellular component
GO:0005139	interleukin-7 receptor binding	IMP	molecular function
GO:2000664	positive regulation of interleukin-5 secretion	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway

Diseases

Associated diseases	References
Eosinophilic esophagitis	KEGG:H01361
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray