• Gene id: 8547

Gene Summary

• Gene Symbol: FCN3   Gene   UCSC   Ensembl
• Aliases: FCNH, HAKA1
• Gene name: ficolin 3
• Alternate names: ficolin-3, H-ficolin, collagen/fibrinogen domain-containing lectin 3 p35, collagen/fibrinogen domain-containing protein 3, ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen),
• Gene location: 1p36.11 (27374851: 27369109)     Exons: 8     NC_000001.11
• Gene summary(Entrez): Ficolins are a group of proteins which consist of a collagen-like domain and a fibrinogen-like domain. In human serum, there are two types of ficolins, both of which have lectin activity. The protein encoded by this gene is a thermolabile beta-2-macroglyc
• OMIM: 604973

Protein Summary

• Protein general information: O75636  
  • Name: Ficolin 3 (Collagen/fibrinogen domain containing lectin 3 p35) (Collagen/fibrinogen domain containing protein 3) (Hakata antigen)
  • Length: 299  
  • Mass: 32903
  • Tissue specificity: Liver and lung. In liver it is produced by bile duct epithelial cells and hepatocytes. In lung it is produced by both ciliated bronchial epithelial cells and type II alveolar epithelial cells. {ECO
• Sequence:

  MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKG
  EPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSY
  RAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSL
  HSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR

• Structural information:
  • Protein Domains: (48..8-)
    (/note="Collagen-like-)
    (84..29-)
    (/note="Fibrinogen-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00739"-)
  • Interpro: IPR036056  IPR014716  IPR014715  IPR002181  IPR020837  
  • Prosite: PS00514 PS51406
  • CDD: cd00087
  • PDB: 1LA5 2J5Z 2J60 2J64
  • PDBsum: 1LA5 2J5Z 2J60 2J64
  • STRING: ENSP00000270879
• Other Databases: GeneCards:  FCN3  Malacards:  FCN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097367	carbohydrate derivative binding	IBA	molecular function
GO:0062023	collagen-containing extracellular matrix	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0001867	complement activation, lectin pathway	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0003823	antigen binding	IBA	molecular function
GO:0001867	complement activation, lectin pathway	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0001867	complement activation, lectin pathway	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005581	collagen trimer	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0030246	carbohydrate binding	TAS	molecular function
GO:0001867	complement activation, lectin pathway	TAS	biological process
GO:0001867	complement activation, lectin pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0006956	complement activation	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0051607	defense response to virus	IDA	biological process
GO:0006956	complement activation	IDA	biological process
GO:1902679	negative regulation of RNA biosynthetic process	IDA	biological process
GO:0043654	recognition of apoptotic cell	IDA	biological process
GO:0003823	antigen binding	IDA	molecular function
GO:0072562	blood microparticle	HDA	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0046597	negative regulation of viral entry into host cell	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881