• Gene id: 85457

Gene Summary

• Gene Symbol: CIPC   Gene   UCSC   Ensembl
• Aliases: KIAA1737
• Gene name: CLOCK interacting pacemaker
• Alternate names: CLOCK-interacting pacemaker, CLOCK-interacting circadian protein, CLOCK-interacting protein, circadian,
• Gene location: 14q24.3 (77098257: 77117286)     Exons: 4     NC_000014.9
• OMIM: 604285

Protein Summary

• Protein general information: Q9C0C6  
  • Name: CLOCK interacting pacemaker (CLOCK interacting circadian protein)
  • Length: 399  
  • Mass: 42692
• Sequence:

  MERKNPSRESPRRLSAKVGKGTEMKKVARQLGMAAAESDKDSGFSDGSSECLSSAEQMESEDMLSALGWSREDRP
  RQNSKTAKNAFPTLSPMVVMKNVLVKQGSSSSQLQSWTVQPSFEVISAQPQLLFLHPPVPSPVSPCHTGEKKSDS
  RNYLPILNSYTKIAPHPGKRGLSLGPEEKGTSGVQKKICTERLGPSLSSSEPTKAGAVPSSPSTPAPPSAKLAED
  SALQGVPSLVAGGSPQTLQPVSSSHVAKAPSLTFASPASPVCASDSTLHGLESNSPLSPLSANYSSPLWAAEHLC
  RSPDIFSEQRQSKHRRFQNTLVVLHKSGLLEITLKTKELIRQNQATQVELDQLKEQTQLFIEATKSRAPQAWAKL
  QASLTPGSSNTGSDLEAFSDHPAI

• Structural information:
  • Interpro: IPR031602  
  • STRING: ENSP00000355319
• Other Databases: GeneCards:  CIPC  Malacards:  CIPC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0042754	negative regulation of circadian rhythm	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0042754	negative regulation of circadian rhythm	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0042754	negative regulation of circadian rhythm	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0042754	negative regulation of circadian rhythm	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881