• Gene id: 85437

Gene Summary

• Gene Symbol: ZCRB1   Gene   UCSC   Ensembl
• Aliases: MADP-1, MADP1, RBM36, SNRNP31, ZCCHC19
• Gene name: zinc finger CCHC-type and RNA binding motif containing 1
• Alternate names: zinc finger CCHC-type and RNA-binding motif-containing protein 1, U11/U12 small nuclear ribonucleoprotein 31 kDa protein, U11/U12 snRNP 31 kDa protein, U11/U12 snRNP 31K, U11/U12-31K, zinc finger CCHC-type and RNA binding motif 1,
• Gene location: 12q12 (64318595: 64316459)     Exons: 6     NC_000011.10
• Gene summary(Entrez): Pre-mRNA splicing is catalyzed by the spliceosome. U12-type spliceosome binds U12-type pre-mRNAs and recognizes the 5' splice site and branch-point sequence. U11 and U12 snRNPs are components of U12-type spliceosome and function as a molecular bridge conn
• OMIM: 610750

Protein Summary

• Protein general information: Q8TBF4  
  • Name: Zinc finger CCHC type and RNA binding motif containing protein 1 (U11/U12 small nuclear ribonucleoprotein 31 kDa protein) (U11/U12 snRNP 31 kDa protein) (U11/U12 31K)
  • Length: 217  
  • Mass: 24592
• Sequence:

  MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRAINNKQ
  LFGRVIKASIAIDNGRAAEFIRRRNYFDKSKCYECGESGHLSYACPKNMLGEREPPKKKEKKKKKKAPEPEEEIE
  EVEESEDEGEDPALDSLSQAIAFQQAKIEEEQKKWKPSSGVPSTSDDSRRPRIKKSTYFSDEEELSD

• Structural information:
  • Protein Domains: (10..8-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR035979  IPR000504  IPR003954  IPR034219   IPR001878  IPR036875  
  • Prosite: PS50102 PS50158
  • CDD: cd12393
  • PDB: 2E5H
  • PDBsum: 2E5H
  • STRING: ENSP00000266529
• Other Databases: GeneCards:  ZCRB1  Malacards:  ZCRB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008380	RNA splicing	IC	biological process
GO:0005689	U12-type spliceosomal complex	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IBA	biological process
GO:0005689	U12-type spliceosomal complex	IBA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0008380	RNA splicing	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)