• Gene id: 85413

Gene Summary

• Gene Symbol: SLC22A16   Gene   UCSC   Ensembl
• Aliases: CT2, FLIPT2, HEL-S-18, OAT6, OCT6, OKB1, dJ261K5.1
• Gene name: solute carrier family 22 member 16
• Alternate names: solute carrier family 22 member 16, WUGSC:RG331P03.1, carnitine transporter 2, epididymis secretory protein Li 18, flipt 2, fly-like putative organic ion transporter 2, fly-like putative transporter 2, organic cation transporter 6, organic cation transporter OKB1,
• Gene location: 6q21-q22.1 (110476673: 110424586)     Exons: 12     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the organic zwitterion transporter protein family which transports carnitine. The encoded protein has also been shown to transport anticancer drugs like bleomycin (PMID: 20037140) successful treatment has been correlated with
• OMIM: 608276

Protein Summary

• Protein general information: Q86VW1  
  • Name: Solute carrier family 22 member 16 (Carnitine transporter 2) (CT2) (Fly like putative transporter 2) (FLIPT2) (Flipt 2) (Organic cation transporter OKB1) (Organic cation/carnitine transporter 6)
  • Length: 577  
  • Mass: 64614
  • Tissue specificity: Widely expressed at low levels in adult tissues and fetal brain, lung, liver and kidney. Expressed in testis and epididymis (at protein level). Expressed at lower levels in bone marrow and fetal liver. Expressed in hematopoietic cells,
• Sequence:

  MGSRHFEGIYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHVCRPPGNVSQVVFHNHSNWSLEDTG
  ALLSSGQKDYVTVQLQNGEIWELSRCSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR
  KWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVLWATSSSMFLFGIAAAFAVDYYTFMAARFFLAMVASGYLVV
  GFVYVMEFIGMKSRTWASVHLHSFFAVGTLLVALTGYLVRTWWLYQMILSTVTVPFILCCWVLPETPFWLLSEGR
  YEEAQKIVDIMAKWNRASSCKLSELLSLDLQGPVSNSPTEVQKHNLSYLFYNWSITKRTLTVWLIWFTGSLGFYS
  FSLNSVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAYSLFCSALACGVVMVIPQKHYILGVVTAMVG
  KFAIGAAFGLIYLYTAELYPTIVRSLAVGSGSMVCRLASILAPFSVDLSSIWIFIPQLFVGTMALLSGVLTLKLP
  ETLGKRLATTWEEAAKLESENESKSSKLLLTTNNSGLEKTEAITPRDSGLGE

• Structural information:
  • Interpro: IPR020846  IPR005828  IPR036259  
  • Prosite: PS50850
  • STRING: ENSP00000357915
• Other Databases: GeneCards:  SLC22A16  Malacards:  SLC22A16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015101	organic cation transmembrane transporter activity	IBA	molecular function
GO:0015695	organic cation transport	IBA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0015695	organic cation transport	IDA	biological process
GO:0015226	carnitine transmembrane transporter activity	IDA	molecular function
GO:0005275	amine transmembrane transporter activity	IDA	molecular function
GO:0015879	carnitine transport	IDA	biological process
GO:0015101	organic cation transmembrane transporter activity	IDA	molecular function
GO:0005886	plasma membrane	IC	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:1902603	carnitine transmembrane transport	IEA	biological process
GO:1902603	carnitine transmembrane transport	IEA	biological process
GO:0015837	amine transport	IEA	biological process
GO:0015879	carnitine transport	IDA	biological process
GO:0046717	acid secretion	IDA	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0015695	organic cation transport	IDA	biological process
GO:0015226	carnitine transmembrane transporter activity	IDA	molecular function
GO:0030317	flagellated sperm motility	IMP	biological process
GO:0007338	single fertilization	IMP	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R