• Gene id: 85409

Gene Summary

• Gene Symbol: NKD2   Gene   UCSC   Ensembl
• Aliases: Naked2
• Gene name: NKD inhibitor of WNT signaling pathway 2
• Alternate names: protein naked cuticle homolog 2, Dvl-binding protein NKD2, NKD2, WNT signaling pathway inhibitor, naked cuticle homolog 2,
• Gene location: 5p15.33 (1008801: 1038942)     Exons: 11     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of a family of proteins that function as negative regulators of Wnt receptor signaling through interaction with Dishevelled family members. The encoded protein participates in the delivery of transforming growth factor alpha-con
• OMIM: 608038

Protein Summary

• Protein general information: Q969F2  
  • Name: Protein naked cuticle homolog 2 (Naked 2) (hNkd2)
  • Length: 451  
  • Mass: 50055
  • Tissue specificity: Expressed in kidney, lung, pancreas and spleen. {ECO
• Sequence:

  MGKLQSKHAAAARKRRESPEGDSFVASAYASGRKGAEEAERRARDKQELPNGDPKEGPFREDQCPLQVALPAEKA
  EGREHPGQLLSADDGERAANREGPRGPGGQRLNIDALQCDVSVEEDDRQEWTFTLYDFDNCGKVTREDMSSLMHT
  IYEVVDASVNHSSGSSKTLRVKLTVSPEPSSKRKEGPPAGQDREPTRCRMEGELAEEPRVADRRLSAHVRRPSTD
  PQPCSERGPYCVDENTERRNHYLDLAGIENYTSRFGPGSPPVQAKQEPQGRASHLQARSRSQEPDTHAVHHRRSQ
  VLVEHVVPASEPAARALDTQPRPKGPEKQFLKSPKGSGKPPGVPASSKSGKAFSYYLPAVLPPQAPQDGHHLPQP
  PPPPYGHKRYRQKGREGHSPLKAPHAQPATVEHEVVRDLPPTPAGEGYAVPVIQRHEHHHHHEHHHHHHHHHFHP
  S

• Structural information:
  • Protein Domains: (119..15-)
    (/note="EF-hand-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448"-)
  • Interpro: IPR011992  IPR002048  IPR040140  
  • Prosite: PS50222
  • DIP: 38642
  • STRING: ENSP00000296849
• Other Databases: GeneCards:  NKD2  Malacards:  NKD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030178	negative regulation of Wnt signaling pathway	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0030178	negative regulation of Wnt signaling pathway	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0010954	positive regulation of protein processing	IDA	biological process
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0016328	lateral plasma membrane	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0071944	cell periphery	IDA	cellular component
GO:1903078	positive regulation of protein localization to plasma membrane	IDA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:0048210	Golgi vesicle fusion to target membrane	IMP	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0051117	ATPase binding	IPI	molecular function
GO:0032036	myosin heavy chain binding	IPI	molecular function
GO:0070382	exocytic vesicle	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04310	Wnt signaling pathway
hsa04390	Hippo signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq