• Gene id: 85407

Gene Summary

• Gene Symbol: NKD1   Gene   UCSC   Ensembl
• Aliases: Naked1
• Gene name: NKD inhibitor of WNT signaling pathway 1
• Alternate names: protein naked cuticle homolog 1, Dvl-binding protein, NKD1, WNT signaling pathway inhibitor, naked cuticle homolog 1, naked cuticle-1, naked-1,
• Gene location: 16q12.1 (50548395: 50649248)     Exons: 12     NC_000016.10
• Gene summary(Entrez): In the mouse, Nkd is a Dishevelled (see DVL1; MIM 601365)-binding protein that functions as a negative regulator of the Wnt (see WNT1; MIM 164820)-beta-catenin (see MIM 116806)-Tcf (see MIM 602272) signaling pathway.[supplied by OMIM, Jun 2003]
• OMIM: 607851

Protein Summary

• Protein general information: Q969G9  
  • Name: Protein naked cuticle homolog 1 (Naked 1) (hNkd) (hNkd1)
  • Length: 470  
  • Mass: 52285
  • Tissue specificity: Expressed in colon, heart, kidney, leukocyte, liver, lung, ovary, pancreas, placenta, prostate, skeletal muscle, small intestine and spleen. {ECO
• Sequence:

  MGKLHSKPAAVCKRRESPEGDSFAVSAAWARKGIEEWIGRQRCPGGVSGPRQLRLAGTIGRSTRELVGDVLRDTL
  SEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPGSKKQLKFEELQCDVSMEEDSRQEWTFTLYDFDNNGK
  VTREDITSLLHTIYEVVDSSVNHSPTSSKMLRVKLTVAPDGSQSKRSVLVNQADLQSARPRAETKPTEDLRSWEK
  KQRAPLRFQGDSRLEQSGCYHHCVDENIERRNHYLDLAGIENYTSQFGPGSPSVAQKSELPPRTSNPTRSRSHEP
  EAIHIPHRKPQGVDPASFHFLDTPIAKVSELQQRLRGTQDGSKHFVRSPKAQGKSVGVGHVARGARNKPPLGPAI
  PAVSPSAHLAASPALLPSLAPLGHKKHKHRAKESQQGCRGLQAPLASGGPVLGREHLRELPALVVYESQAGQPVQ
  RHEHHHHHEHHHHYHHFYQT

• Structural information:
  • Protein Domains: (131..16-)
    (/note="EF-hand-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448"-)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR040140  
  • Prosite: PS00018 PS50222
  • DIP: 38248
  • STRING: ENSP00000268459
• Other Databases: GeneCards:  NKD1  Malacards:  NKD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030178	negative regulation of Wnt signaling pathway	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0030178	negative regulation of Wnt signaling pathway	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000096	positive regulation of Wnt signaling pathway, planar cell polarity pathway	IEA	biological process
GO:1901233	negative regulation of convergent extension involved in axis elongation	IEA	biological process
GO:1901231	positive regulation of non-canonical Wnt signaling pathway via JNK cascade	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IEA	biological process
GO:0030165	PDZ domain binding	IEA	molecular function
GO:0000159	protein phosphatase type 2A complex	IDA	cellular component
GO:0007525	somatic muscle development	ISS	biological process
GO:0045732	positive regulation of protein catabolic process	IMP	biological process
GO:0001754	eye photoreceptor cell differentiation	ISS	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0090249	regulation of cell motility involved in somitogenic axis elongation	ISS	biological process
GO:1901231	positive regulation of non-canonical Wnt signaling pathway via JNK cascade	ISS	biological process
GO:1901233	negative regulation of convergent extension involved in axis elongation	ISS	biological process
GO:2000096	positive regulation of Wnt signaling pathway, planar cell polarity pathway	ISS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04310	Wnt signaling pathway
hsa04390	Hippo signaling pathway
hsa04390	Hippo signaling pathway
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Spermatogenesis defects	MIK: 15546883
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray