• Gene id: 8540

Gene Summary

• Gene Symbol: AGPS   Gene   UCSC   Ensembl
• Aliases: ADAP-S, ADAS, ADHAPS, ADPS, ALDHPSY, RCDP3
• Gene name: alkylglycerone phosphate synthase
• Alternate names: alkyldihydroxyacetonephosphate synthase, peroxisomal, aging-associated gene 5 protein, aging-associated protein 5, alkyl-DHAP synthase,
• Gene location: 2q31.2 (177392772: 177543833)     Exons: 21     NC_000002.12
• Gene summary(Entrez): This gene is a member of the FAD-binding oxidoreductase/transferase type 4 family. It encodes a protein that catalyzes the second step of ether lipid biosynthesis in which acyl-dihydroxyacetonephosphate (DHAP) is converted to alkyl-DHAP by the addition of
• OMIM: 603051

Protein Summary

• Protein general information: O00116  
  • Name: Alkyldihydroxyacetonephosphate synthase, peroxisomal (Alkyl DHAP synthase) (EC 2.5.1.26) (Aging associated gene 5 protein) (Alkylglycerone phosphate synthase)
  • Length: 658  
  • Mass: 72912
• Sequence:

  MAEAAAAAGGTGLGAGASYGSAADRDRDPDPDRAGRRLRVLSGHLLGRPREALSTNECKARRAASAATAAPTATP
  AAQESGTIPKKRQEVMKWNGWGYNDSKFIFNKKGQIELTGKRYPLSGMGLPTFKEWIQNTLGVNVEHKTTSKASL
  NPSDTPPSVVNEDFLHDLKETNISYSQEADDRVFRAHGHCLHEIFLLREGMFERIPDIVLWPTCHDDVVKIVNLA
  CKYNLCIIPIGGGTSVSYGLMCPADETRTIISLDTSQMNRILWVDENNLTAHVEAGITGQELERQLKESGYCTGH
  EPDSLEFSTVGGWVSTRASGMKKNIYGNIEDLVVHIKMVTPRGIIEKSCQGPRMSTGPDIHHFIMGSEGTLGVIT
  EATIKIRPVPEYQKYGSVAFPNFEQGVACLREIAKQRCAPASIRLMDNKQFQFGHALKPQVSSIFTSFLDGLKKF
  YITKFKGFDPNQLSVATLLFEGDREKVLQHEKQVYDIAAKFGGLAAGEDNGQRGYLLTYVIAYIRDLALEYYVLG
  ESFETSAPWDRVVDLCRNVKERITRECKEKGVQFAPFSTCRVTQTYDAGACIYFYFAFNYRGISDPLTVFEQTEA
  AAREEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKEYVDPNNIFGNRNLL

• Structural information:
  • Protein Domains: (202..38-)
    (/note="FAD-binding-PCMH-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00718"-)
  • Interpro: IPR025650  IPR016166  IPR036318  IPR016167  IPR016169   IPR016164  IPR004113  IPR006094  IPR016171  
  • Prosite: PS51387
  • STRING: ENSP00000264167
• Other Databases: GeneCards:  AGPS  Malacards:  AGPS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008609	alkylglycerone-phosphate synthase activity	IDA	molecular function
GO:0071949	FAD binding	ISS	molecular function
GO:0008611	ether lipid biosynthetic process	ISS	biological process
GO:0008610	lipid biosynthetic process	IEA	biological process
GO:0050660	flavin adenine dinucleotide binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0071949	FAD binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0008609	alkylglycerone-phosphate synthase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0008609	alkylglycerone-phosphate synthase activity	IEA	molecular function
GO:0008610	lipid biosynthetic process	IDA	biological process
GO:0008609	alkylglycerone-phosphate synthase activity	IDA	molecular function
GO:0005777	peroxisome	IDA	cellular component
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006625	protein targeting to peroxisome	TAS	biological process
GO:0008611	ether lipid biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005777	peroxisome	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0008611	ether lipid biosynthetic process	IEA	biological process
GO:0008609	alkylglycerone-phosphate synthase activity	IDA	molecular function
GO:0005777	peroxisome	IDA	cellular component
GO:0005739	mitochondrion	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005778	peroxisomal membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04146	Peroxisome
hsa00565	Ether lipid metabolism

Diseases

Associated diseases	References
Rhizomelic chondrodysplasia punctata	KEGG:H00207
Rhizomelic chondrodysplasia punctata	KEGG:H00207
Rhizomelic chondrodysplasia punctata	PMID:9553082
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray