• Gene id: 85397

Gene Summary

• Gene Symbol: RGS8   Gene   UCSC   Ensembl
• Gene name: regulator of G protein signaling 8
• Alternate names: regulator of G-protein signaling 8, regulator of G-protein signalling 8,
• Gene location: 1q25.3 (182753292: 182641813)     Exons: 15     NC_000001.11
• Gene summary(Entrez): This gene is a member of the regulator of G protein signaling (RGS) family and encodes a protein with a single RGS domain. Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. Th

Protein Summary

• Protein general information: P57771  
  • Name: Regulator of G protein signaling 8 (RGS8)
  • Length: 180  
  • Mass: 20917
• Sequence:

  MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVLLSHKYGVAAFRAFLK
  TEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPREVNIDFQTREATRKNLQEPSLTCFDQAQGKV
  HSLMEKDSYPRFLRSKMYLDLLSQSQRRLS

• Structural information:
  • Protein Domains: (56..17-)
    (/note="RGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00171"-)
  • Interpro: IPR016137  IPR034948  IPR034949  IPR036305  IPR024066  
  • Prosite: PS50132
  • CDD: cd08711
  • PDB: 2IHD 2ODE 5DO9
  • PDBsum: 2IHD 2ODE 5DO9
  • DIP: 59093
  • STRING: ENSP00000258302
• Other Databases: GeneCards:  RGS8  Malacards:  RGS8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0030425	dendrite	ISS	cellular component
GO:0032809	neuronal cell body membrane	ISS	cellular component
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0060159	regulation of dopamine receptor signaling pathway	ISS	biological process
GO:0007213	G protein-coupled acetylcholine receptor signaling pathway	ISS	biological process
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0003924	GTPase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0045202	synapse	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq