• Gene id: 85395

Gene Summary

• Gene Symbol: FAM207A   Gene   UCSC   Ensembl
• Aliases: C21orf70, PRED56
• Gene name: family with sequence similarity 207 member A
• Alternate names: protein FAM207A,
• Gene location: 21q22.3 (44939696: 44976988)     Exons: 9     NC_000021.9
• OMIM: 601755

Protein Summary

• Protein general information: Q9NSI2  
  • Name: Protein FAM207A
  • Length: 230  
  • Mass: 25456
  • Tissue specificity: Not detected in any tested tissue.
• Sequence:

  MGKVRGLRARVHQAAVRPKGEAAPGPAPPAPEATPPPASAAGKDWAFINTNIFARTKIDPSALVQKLELDVRSVT
  SVRRGEAGSSARSVPSIRRGAEAKTVLPKKEKMKLRREQWLQKIEAIKLAEQKHREERRRRATVVVGDLHPLRDA
  LPELLGLEAGSRRQARSRESNKPRPSELSRMSAAQRQQLLEEERTRFQELLASPAYRASPLVAIGQTLARQMQLE
  DGGQL

• Structural information:
  • Interpro: IPR028160  
  • STRING: ENSP00000291634
• Other Databases: GeneCards:  FAM207A  Malacards:  FAM207A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0030686	90S preribosome	IEA	cellular component
GO:0030688	preribosome, small subunit precursor	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881