• Gene id: 8539

Gene Summary

• Gene Symbol: API5   Gene   UCSC   Ensembl
• Aliases: AAC-11, AAC11
• Gene name: apoptosis inhibitor 5
• Alternate names: apoptosis inhibitor 5, FIF, antiapoptosis clone 11 protein, cell migration-inducing gene 8 protein, fibroblast growth factor 2-interacting factor 2, migration-inducing protein MIG8,
• Gene location: 11p12 (43311969: 43344529)     Exons: 15     NC_000011.10
• Gene summary(Entrez): This gene encodes an apoptosis inhibitory protein whose expression prevents apoptosis after growth factor deprivation. This protein suppresses the transcription factor E2F1-induced apoptosis and also interacts with, and negatively regulates Acinus, a nucl
• OMIM: 609774

Protein Summary

• Protein general information: Q9BZZ5  
  • Name: Apoptosis inhibitor 5 (API 5) (Antiapoptosis clone 11 protein) (AAC 11) (Cell migration inducing gene 8 protein) (Fibroblast growth factor 2 interacting factor) (FIF) (Protein XAGL)
  • Length: 524  
  • Mass: 59005
  • Tissue specificity: Expressed in all tissues tested, including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highest levels in heart, pancreas and placenta. Highly expressed in several cancers. Preferentially expressed in squa
• Sequence:

  MPTVEELYRNYGILADATEQVGQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDED
  VSIRRQAIKELPQFATGENLPRVADILTQLLQTDDSAEFNLVNNALLSIFKMDAKGTLGGLFSQILQGEDIVRER
  AIKFLSTKLKTLPDEVLTKEVEELILTESKKVLEDVTGEEFVLFMKILSGLKSLQTVSGRQQLVELVAEQADLEQ
  TFNPSDPDCVDRLLQCTRQAVPLFSKNVHSTRFVTYFCEQVLPNLGTLTTPVEGLDIQLEVLKLLAEMSSFCGDM
  EKLETNLRKLFDKLLEYMPLPPEEAENGENAGNEEPKLQFSYVECLLYSFHQLGRKLPDFLTAKLNAEKLKDFKI
  RLQYFARGLQVYIRQLRLALQGKTGEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWKPVQKVE
  IGQKRASEDTTSGSPPKKSSAGPKRDARQIYNPPSGKYSSNLGNFNYEQRGAFRGSRGGRGWGTRGNRSRGRLY

• Structural information:
  • Interpro: IPR008383  IPR016024  
  • PDB: 3U0R 3V6A
  • PDBsum: 3U0R 3V6A
  • STRING: ENSP00000431391
• Other Databases: GeneCards:  API5  Malacards:  API5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043066	negative regulation of apoptotic process	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005681	spliceosomal complex	IEA	cellular component
GO:2000270	negative regulation of fibroblast apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0005737	cytoplasm	NAS	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043066	negative regulation of apoptotic process	NAS	biological process
GO:0017134	fibroblast growth factor binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:0005681	spliceosomal complex	ISS	cellular component

Diseases

Associated diseases	References
cervical cancer	PMID:10780674
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881