• Gene id: 85363

Gene Summary

• Gene Symbol: TRIM5   Gene   UCSC   Ensembl
• Aliases: RNF88, TRIM5alpha
• Gene name: tripartite motif containing 5
• Alternate names: tripartite motif-containing protein 5, RING-type E3 ubiquitin transferase TRIM5, ring finger protein 88, tripartite motif containing 5 transcript variant iota, tripartite motif containing 5 transcript variant kappa, tripartite motif protein TRIM5,
• Gene location: 11p15.4 (5685107: 5590905)     Exons: 12     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein forms homo-oligomers via the coilel-co
• OMIM: 165196

Protein Summary

• Protein general information: Q9C035  
  • Name: Tripartite motif containing protein 5 (EC 2.3.2.27) (RING finger protein 88) (RING type E3 ubiquitin transferase TRIM5)
  • Length: 493  
  • Mass: 56338
• Sequence:

  MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRISYQPENIRPNRHVAN
  IVEKLREVKLSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQVKLQAALEMLR
  QKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDILKSLTNSETEMVQQT
  QSLRELISDLEHRLQGSVMELLQGVDGVIKRTENVTLKKPETFPKNQRRVFRAPDLKGMLEVFRELTDVRRYWVD
  VTVAPNNISCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILGSQSITSGKHYWEVDVSKKTAWILGV
  CAGFQPDAMCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDSSFHTPSVPFIVPLSVIICPDRVGVFLDYEACTVS
  FFNITNHGFLIYKFSHCSFSQPVFPYLNPRKCGVPMTLCSPSS

• Structural information:
  • Protein Domains: (281..49-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR003879  IPR013320  IPR003877  IPR032917   IPR027370  IPR000315  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50188 PS50119 PS00518 PS50089
  • CDD: cd00021
  • PDB: 2ECV 2YRG
  • PDBsum: 2ECV 2YRG
  • STRING: ENSP00000369373
• Other Databases: GeneCards:  TRIM5  Malacards:  TRIM5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042803	protein homodimerization activity	IBA	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0010508	positive regulation of autophagy	IBA	biological process
GO:0016567	protein ubiquitination	IBA	biological process
GO:0019901	protein kinase binding	IBA	molecular function
GO:0032880	regulation of protein localization	IBA	biological process
GO:0046596	regulation of viral entry into host cell	IBA	biological process
GO:0070534	protein K63-linked ubiquitination	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0000932	P-body	IDA	cellular component
GO:0038187	pattern recognition receptor activity	IDA	molecular function
GO:0002218	activation of innate immune response	IDA	biological process
GO:0051607	defense response to virus	TAS	biological process
GO:0051607	defense response to virus	TAS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0031664	regulation of lipopolysaccharide-mediated signaling pathway	IMP	biological process
GO:0043410	positive regulation of MAPK cascade	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004842	ubiquitin-protein transferase activity	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:1902187	negative regulation of viral release from host cell	IDA	biological process
GO:0046597	negative regulation of viral entry into host cell	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0045087	innate immune response	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:1990462	omegasome	IDA	colocalizes with
GO:0006914	autophagy	IDA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032880	regulation of protein localization	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030674	protein-macromolecule adaptor activity	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05170	Human immunodeficiency virus 1 infection

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray