• Gene id: 8536

Gene Summary

• Gene Symbol: CAMK1   Gene   UCSC   Ensembl
• Aliases: CAMKI
• Gene name: calcium/calmodulin dependent protein kinase I
• Alternate names: calcium/calmodulin-dependent protein kinase type 1, caM kinase I alpha, caM-KI, caMKI-alpha,
• Gene location: 3p25.3 (9769986: 9757344)     Exons: 13     NC_000003.12
• Gene summary(Entrez): Calcium/calmodulin-dependent protein kinase I is expressed in many tissues and is a component of a calmodulin-dependent protein kinase cascade. Calcium/calmodulin directly activates calcium/calmodulin-dependent protein kinase I by binding to the enzyme a

SNPs

rs1052133

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000003.12   g.9757089C>G
NC_000003.12   g.9757089C>T
NC_000003.11   g.9798773C>G
NC_000003.11   g.9798773C>T
NG_012106.1   g.12146C>G
NG_012106.1   g.12146C>T
NM_002542.5   c.977C>G
NM_002542.5   c.977C>T
NM_016819.3   c.*246C>G
NM_016819.3   c.*246C>T
NM_016820.3   c.

Protein Summary

• Protein general information: Q14012  
  • Name: Calcium/calmodulin dependent protein kinase type 1 (EC 2.7.11.17) (CaM kinase I) (CaM KI) (CaM kinase I alpha) (CaMKI alpha)
  • Length: 370  
  • Mass: 41337
  • Tissue specificity: Widely expressed. Expressed in cells of the zona glomerulosa of the adrenal cortex. {ECO
• Sequence:

  MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKEGSMENEIAVLHKIKH
  PNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYY
  SLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAK
  LFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAK
  SKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCCCRDCCVEPGTELSPTLPHQL

• Structural information:
  • Protein Domains: (20..27-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 4FG7 4FG8 4FG9 4FGB
  • PDBsum: 4FG7 4FG8 4FG9 4FGB
  • DIP: 41906
  • STRING: ENSP00000256460
• Other Databases: GeneCards:  CAMK1  Malacards:  CAMK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004683	calmodulin-dependent protein kinase activity	IBA	molecular function
GO:0005516	calmodulin binding	IBA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0071902	positive regulation of protein serine/threonine kinase activity	IDA	biological process
GO:0051147	regulation of muscle cell differentiation	IDA	biological process
GO:0043393	regulation of protein binding	IDA	biological process
GO:0032880	regulation of protein localization	IDA	biological process
GO:0010976	positive regulation of neuron projection development	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0060999	positive regulation of dendritic spine development	IMP	biological process
GO:0004683	calmodulin-dependent protein kinase activity	ISS	molecular function
GO:0051835	positive regulation of synapse structural plasticity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0008152	metabolic process	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0007399	nervous system development	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0004683	calmodulin-dependent protein kinase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0004683	calmodulin-dependent protein kinase activity	IEA	molecular function
GO:0046827	positive regulation of protein export from nucleus	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0050807	regulation of synapse organization	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0006913	nucleocytoplasmic transport	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0051149	positive regulation of muscle cell differentiation	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0046827	positive regulation of protein export from nucleus	IDA	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IMP	biological process
GO:0060143	positive regulation of syncytium formation by plasma membrane fusion	IMP	biological process
GO:2000615	regulation of histone H3-K9 acetylation	IMP	NOT|biological process
GO:1901985	positive regulation of protein acetylation	IMP	biological process
GO:1901985	positive regulation of protein acetylation	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04020	Calcium signaling pathway
hsa04921	Oxytocin signaling pathway
hsa04925	Aldosterone synthesis and secretion
hsa05214	Glioma

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq