• Gene id: 85329

Gene Summary

• Gene Symbol: LGALS12   Gene   UCSC   Ensembl
• Aliases: GAL12, GRIP1
• Gene name: galectin 12
• Alternate names: galectin-12, galectin-related inhibitor of proliferation, lectin, galactoside-binding, soluble, 12, testicular secretory protein Li 26,
• Gene location: 11q12.3 (389346: 442641)     Exons: 14     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the galectin superfamily, a group of beta-galactoside-binding proteins with conserved carbohydrate recognition domains. The related mouse protein is a primary regulator of the early stages of adipose tissue development. Alter
• OMIM: 606096

Protein Summary

• Protein general information: Q96DT0  
  • Name: Galectin 12 (Gal 12) (Galectin related inhibitor of proliferation)
  • Length: 336  
  • Mass: 37542
  • Tissue specificity: Not widely expressed. Predominantly expressed in adipose tissue.
• Sequence:

  MSQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLHAGKMVMLQGVVPLDAHR
  FQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQREARWPHLALRRGSSFLILFLFGNEEVKVSVN
  GQHFLHFRYRLPLSHVDTLGIFGDILVEAVGFLNINPFVEGSREYPAGHPFLLMSPRLEVPCSHALPQGLSPGQV
  IIVRGLVLQEPKHFTVSLRDQAAHAPVTLRASFADRTLAWISRWGQKKLISAPFLFYPQRFFEVLLLFQEGGLKL
  ALNGQGLGATSMNQQALEQLRELRISGSVQLYCVHS

• Structural information:
  • Protein Domains: (49..18-)
    (/note="Galectin-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00639-)
    (212..33-)
    (/note="Galectin-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00639"-)
  • Interpro: IPR013320  IPR030649  IPR001079  
  • Prosite: PS51304
  • CDD: cd00070
  • STRING: ENSP00000339374
• Other Databases: GeneCards:  LGALS12  Malacards:  LGALS12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097193	intrinsic apoptotic signaling pathway	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0030395	lactose binding	IBA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0045598	regulation of fat cell differentiation	IEA	biological process
GO:0050994	regulation of lipid catabolic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0097193	intrinsic apoptotic signaling pathway	IDA	biological process
GO:0030395	lactose binding	IDA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)