• Gene id: 85315

Gene Summary

• Gene Symbol: PAQR8   Gene   UCSC   Ensembl
• Aliases: C6orf33, LMPB1, MPRB
• Gene name: progestin and adipoQ receptor family member 8
• Alternate names: membrane progestin receptor beta, lysosomal membrane protein in brain-1, mPR beta, membrane progesterone P4 receptor beta, membrane progesterone receptor beta, progesterone and adipoQ receptor family member 8, progestin and adipoQ receptor family member VIII,
• Gene location: 6p12.2 (52362150: 52407776)     Exons: 2     NC_000006.12
• OMIM: 607780

Protein Summary

• Protein general information: Q8TEZ7  
  • Name: Membrane progestin receptor beta (mPR beta) (Lysosomal membrane protein in brain 1) (Membrane progesterone P4 receptor beta) (Membrane progesterone receptor beta) (Progesterone and adipoQ receptor family member 8) (Progestin and adipoQ receptor family mem
  • Length: 354  
  • Mass: 40464
  • Tissue specificity: Highly expressed in the hypothalamus (PubMed
• Sequence:

  MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGHEWRYYFFSLFQKHNE
  VVNVWTHLLAALAVLLRFWAFAEAEALPWASTHSLPLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVG
  VSVYQYGSALAHFFYSSDQAWYDRFWLFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFILDI
  SPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAI
  LLDYQGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS

• Structural information:
  • Interpro: IPR004254  
  • STRING: ENSP00000406197
• Other Databases: GeneCards:  PAQR8  Malacards:  PAQR8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003707	steroid hormone receptor activity	IBA	molecular function
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0048545	response to steroid hormone	IBA	biological process
GO:0005496	steroid binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0048477	oogenesis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005496	steroid binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881