• Gene id: 85313

Gene Summary

• Gene Symbol: PPIL4   Gene   UCSC   Ensembl
• Aliases: HDCME13P
• Gene name: peptidylprolyl isomerase like 4
• Alternate names: peptidyl-prolyl cis-trans isomerase-like 4, PPIase, cyclophilin-like protein PPIL4, cyclophilin-type peptidyl-prolyl cis-trans isomerase, peptidylprolyl isomerase (cyclophilin)-like 4, rotamase PPIL4, serologically defined breast cancer antigen NY-BR-18,
• Gene location: 6q25.1 (149546042: 149504494)     Exons: 13     NC_000006.12
• Gene summary(Entrez): This gene is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. [
• OMIM: 607609

Protein Summary

• Protein general information: Q8WUA2  
  • Name: Peptidyl prolyl cis trans isomerase like 4 (PPIase) (EC 5.2.1.8) (Cyclophilin like protein PPIL4) (Rotamase PPIL4)
  • Length: 492  
  • Mass: 57225
  • Tissue specificity: Abundantly expressed in kidney but has a ubiquitously low expression pattern in other adult tissues. {ECO
• Sequence:

  MAVLLETTLGDVVIDLYTEERPRACLNFLKLCKIKYYNYCLIHNVQRDFIIQTGDPTGTGRGGESIFGQLYGDQA
  SFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLDGVHTVFGEVTEGMDIIKKINETFVDKDFVP
  YQDIRINHTVILDDPFDDPPDLLIPDRSPEPTREQLDSGRIGADEEIDDFKGRSAEEVEEIKAEKEAKTQAILLE
  MVGDLPDADIKPPENVLFVCKLNPVTTDEDLEIIFSRFGPIRSCEVIRDWKTGESLCYAFIEFEKEEDCEKAFFK
  MDNVLIDDRRIHVDFSQSVAKVKWKGKGGKYTKSDFKEYEKEQDKPPNLVLKDKVKPKQDTKYDLILDEQAEDSK
  SSHSHTSKKHKKKTHHCSEEKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRSRSRERD
  GHYSNSHKSKYQTDLYERERSKKRDRSRSPKKSKDKEKSKYR

• Structural information:
  • Protein Domains: (1..16-)
    (/note="PPIase-cyclophilin-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00156-)
    (240..31-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR035542  IPR029000  IPR002130  IPR035538  IPR012677   IPR035979  IPR000504  
  • Prosite: PS50072 PS50102
  • CDD: cd01921
  • STRING: ENSP00000253329
• Other Databases: GeneCards:  PPIL4  Malacards:  PPIL4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:1901407	regulation of phosphorylation of RNA polymerase II C-terminal domain	IBA	biological process
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016853	isomerase activity	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)