• Gene id: 8530

Gene Summary

• Gene Symbol: CST7   Gene   UCSC   Ensembl
• Aliases: CMAP
• Gene name: cystatin F
• Alternate names: cystatin-F, cystatin-7, cystatin-like metastasis-associated protein, leukocystatin,
• Gene location: 20p11.21 (24949268: 24959927)     Exons: 4     NC_000020.11
• Gene summary(Entrez): The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory
• OMIM: 611903

Protein Summary

• Protein general information: O76096  
  • Name: Cystatin F (Cystatin 7) (Cystatin like metastasis associated protein) (CMAP) (Leukocystatin)
  • Length: 145  
  • Mass: 16454
  • Tissue specificity: Primarily expressed in peripheral blood cells and spleen.
• Sequence:

  MRAAGTLLAFCCLVLSTTGGPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRI
  TRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH

• Structural information:
  • Interpro: IPR042886  IPR000010  
  • CDD: cd00042
  • PDB: 2CH9
  • PDBsum: 2CH9
  • STRING: ENSP00000420384
• Other Databases: GeneCards:  CST7  Malacards:  CST7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0030414	peptidase inhibitor activity	IDA	molecular function
GO:0030414	peptidase inhibitor activity	IDA	molecular function
GO:0030414	peptidase inhibitor activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0005764	lysosome	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005771	multivesicular body	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0010466	negative regulation of peptidase activity	IDA	biological process
GO:0010466	negative regulation of peptidase activity	IDA	biological process
GO:0010466	negative regulation of peptidase activity	IDA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005764	lysosome	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0031643	positive regulation of myelination	IBA	biological process
GO:0004869	cysteine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0005770	late endosome	IBA	cellular component
GO:0097340	inhibition of cysteine-type endopeptidase activity	IBA	biological process
GO:1903979	negative regulation of microglial cell activation	IBA	biological process
GO:0004869	cysteine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0004869	cysteine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004866	endopeptidase inhibitor activity	TAS	molecular function
GO:0004869	cysteine-type endopeptidase inhibitor activity	TAS	molecular function
GO:0006955	immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0031643	positive regulation of myelination	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:1903979	negative regulation of microglial cell activation	IEA	biological process
GO:0097340	inhibition of cysteine-type endopeptidase activity	IEA	biological process
GO:0005770	late endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004869	cysteine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray