• Gene id: 8529

Gene Summary

• Gene Symbol: CYP4F2   Gene   UCSC   Ensembl
• Aliases: CPF2
• Gene name: cytochrome P450 family 4 subfamily F member 2
• Alternate names: cytochrome P450 4F2, 20-HETE synthase, 20-hydroxyeicosatetraenoic acid synthase, CYPIVF2, arachidonic acid omega-hydroxylase, cytochrome P450, family 4, subfamily F, polypeptide 2, cytochrome P450, subfamily IVF, polypeptide 2, cytochrome P450-LTB-omega, docosahe,
• Gene location: 19p13.12 (15898073: 15878022)     Exons: 13     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local
• OMIM: 605347

Protein Summary

• Protein general information: P78329  
  • Name: Cytochrome P450 4F2 (EC 1.14.14.1) (20 hydroxyeicosatetraenoic acid synthase) (20 HETE synthase) (Arachidonic acid omega hydroxylase) (CYPIVF2) (Cytochrome P450 LTB omega) (Docosahexaenoic acid omega hydroxylase) (EC 1.14.14.79) (Leukotriene B(4) 20 monoo
  • Length: 520  
  • Mass: 59853
  • Tissue specificity: Liver. Also present in kidney
• Sequence:

  MSQLSLSWLGLWPVAASPWLLLLLVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWFWGHQGMVNPTEEGMR
  VLTQLVATYPQGFKVWMGPISPLLSLCHPDIIRSVINASAAIAPKDKFFYSFLEPWLGDGLLLSAGDKWSRHRRM
  LTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSACLDMFEHISLMTLDSLQKCVFSFDSHCQEKPSEYIAAI
  LELSALVSKRHHEILLHIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFID
  VLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDL
  AHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPENI
  KERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRVLPDHTEPRRKPELVLRAEGGLWLRVEPLS

• Structural information:
  • Interpro: IPR001128  IPR017972  IPR002401  IPR036396  
  • Prosite: PS00086
  • STRING: ENSP00000221700
• Other Databases: GeneCards:  CYP4F2  Malacards:  CYP4F2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004497	monooxygenase activity	IBA	molecular function
GO:0008391	arachidonic acid monooxygenase activity	IBA	molecular function
GO:0042361	menaquinone catabolic process	IBA	biological process
GO:0042376	phylloquinone catabolic process	IBA	biological process
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0050051	leukotriene-B4 20-monooxygenase activity	IBA	molecular function
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0019369	arachidonic acid metabolic process	IBA	biological process
GO:0036101	leukotriene B4 catabolic process	IBA	biological process
GO:0042377	vitamin K catabolic process	IBA	biological process
GO:0042361	menaquinone catabolic process	IDA	biological process
GO:0016709	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen	IDA	molecular function
GO:0042376	phylloquinone catabolic process	IDA	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0016709	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen	IDA	molecular function
GO:0042377	vitamin K catabolic process	IDA	biological process
GO:0042377	vitamin K catabolic process	IDA	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0005506	iron ion binding	IEA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA	molecular function
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0070330	aromatase activity	IEA	molecular function
GO:0050051	leukotriene-B4 20-monooxygenase activity	IEA	molecular function
GO:0006690	icosanoid metabolic process	TAS	biological process
GO:0097267	omega-hydroxylase P450 pathway	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006691	leukotriene metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0018685	alkane 1-monooxygenase activity	IDA	molecular function
GO:0000038	very long-chain fatty acid metabolic process	IDA	biological process
GO:0001676	long-chain fatty acid metabolic process	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0042376	phylloquinone catabolic process	IEA	biological process
GO:0019369	arachidonic acid metabolic process	IEA	biological process
GO:0052869	arachidonic acid omega-hydroxylase activity	IDA	molecular function
GO:0052869	arachidonic acid omega-hydroxylase activity	IDA	molecular function
GO:0050051	leukotriene-B4 20-monooxygenase activity	IDA	molecular function
GO:0050051	leukotriene-B4 20-monooxygenase activity	IDA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0008392	arachidonic acid epoxygenase activity	IDA	molecular function
GO:0036101	leukotriene B4 catabolic process	IDA	biological process
GO:0036101	leukotriene B4 catabolic process	IDA	biological process
GO:0019373	epoxygenase P450 pathway	IDA	biological process
GO:0019369	arachidonic acid metabolic process	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0052872	tocotrienol omega-hydroxylase activity	IDA	molecular function
GO:0052871	alpha-tocopherol omega-hydroxylase activity	IDA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0008392	arachidonic acid epoxygenase activity	IDA	molecular function
GO:0042360	vitamin E metabolic process	IDA	biological process
GO:0036101	leukotriene B4 catabolic process	IDA	biological process
GO:0019373	epoxygenase P450 pathway	IDA	biological process
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0003095	pressure natriuresis	IEP	biological process
GO:0003091	renal water homeostasis	IEP	biological process
GO:0032305	positive regulation of icosanoid secretion	IMP	biological process
GO:0032304	negative regulation of icosanoid secretion	IMP	biological process
GO:0008217	regulation of blood pressure	IMP	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0017144	drug metabolic process	IMP	biological process
GO:0017144	drug metabolic process	IMP	biological process
GO:0055078	sodium ion homeostasis	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00590	Arachidonic acid metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R