• Gene id: 8520

Gene Summary

• Gene Symbol: HAT1   Gene   UCSC   Ensembl
• Aliases: KAT1
• Gene name: histone acetyltransferase 1
• Alternate names: histone acetyltransferase type B catalytic subunit,
• Gene location: 2q31.1 (171922424: 171983685)     Exons: 12     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a type B histone acetyltransferase (HAT) that is involved in the rapid acetylation of newly synthesized cytoplasmic histones, which are in turn imported into the nucleus for de novo deposition onto nascent DNA chains. H
• OMIM: 601306

Protein Summary

• Protein general information: O14929  
  • Name: Histone acetyltransferase type B catalytic subunit (EC 2.3.1.48) (Histone acetyltransferase 1)
  • Length: 419  
  • Mass: 49513
• Sequence:

  MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKIL
  LYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLS
  PTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVY
  NYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCF
  SREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRK
  CLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE

• Structural information:
  • Interpro: IPR016181  IPR019467  IPR037113  IPR017380  IPR013523  
  • PDB: 2P0W 6UHD
  • PDBsum: 2P0W 6UHD
  • DIP: 52811
  • STRING: ENSP00000264108
• Other Databases: GeneCards:  HAT1  Malacards:  HAT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0043967	histone H4 acetylation	IBA	biological process
GO:0010485	H4 histone acetyltransferase activity	IBA	molecular function
GO:0042393	histone binding	IBA	molecular function
GO:0010485	H4 histone acetyltransferase activity	IDA	molecular function
GO:0043967	histone H4 acetylation	IDA	biological process
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0006348	chromatin silencing at telomere	IEA	biological process
GO:0042393	histone binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016573	histone acetylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004402	histone acetyltransferase activity	TAS	molecular function
GO:0006323	DNA packaging	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0006475	internal protein amino acid acetylation	TAS	biological process
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007584	response to nutrient	IEA	biological process
GO:0000784	nuclear chromosome, telomeric region	HDA	cellular component
GO:0016363	nuclear matrix	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0006336	DNA replication-independent nucleosome assembly	IDA	biological process
GO:0006335	DNA replication-dependent nucleosome assembly	IDA	biological process
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0043967	histone H4 acetylation	IBA	biological process
GO:0010485	H4 histone acetyltransferase activity	IBA	molecular function
GO:0042393	histone binding	IBA	molecular function
GO:0010485	H4 histone acetyltransferase activity	IDA	molecular function
GO:0043967	histone H4 acetylation	IDA	biological process
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0006348	chromatin silencing at telomere	IEA	biological process
GO:0042393	histone binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016573	histone acetylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004402	histone acetyltransferase activity	TAS	molecular function
GO:0006323	DNA packaging	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0006475	internal protein amino acid acetylation	TAS	biological process
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007584	response to nutrient	IEA	biological process
GO:0000784	nuclear chromosome, telomeric region	HDA	cellular component
GO:0016363	nuclear matrix	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0006336	DNA replication-independent nucleosome assembly	IDA	biological process
GO:0006335	DNA replication-dependent nucleosome assembly	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05034	Alcoholism

Diseases

Associated diseases	References
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881