• Gene id: 8519

Gene Summary

• Gene Symbol: IFITM1   Gene   UCSC   Ensembl
• Aliases: 9-27, CD225, DSPA2a, IFI17, LEU13
• Gene name: interferon induced transmembrane protein 1
• Alternate names: interferon-induced transmembrane protein 1, dispanin subfamily A member 2a, interferon-induced protein 17, interferon-inducible protein 9-27, leu-13 antigen,
• Gene location: 11p15.5 (314039: 315271)     Exons: 2     NC_000011.10
• OMIM: 604456

Protein Summary

• Protein general information: P13164  
  • Name: Interferon induced transmembrane protein 1 (Dispanin subfamily A member 2a) (DSPA2a) (Interferon induced protein 17) (Interferon inducible protein 9 27) (Leu 13 antigen) (CD antigen CD225)
  • Length: 125  
  • Mass: 13964
  • Tissue specificity: Bone (at protein level). Levels greatly elevated in colon cancer, cervical cancer, esophageal cancer and ovarian cancer. Expressed in glioma cell lines. {ECO
• Sequence:

  MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGA
  QAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY

• Structural information:
  • Interpro: IPR007593  
  • DIP: 32672
  • STRING: ENSP00000386187
• Other Databases: GeneCards:  IFITM1  Malacards:  IFITM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046597	negative regulation of viral entry into host cell	IDA	biological process
GO:0060337	type I interferon signaling pathway	IBA	biological process
GO:0051607	defense response to virus	IBA	biological process
GO:0045071	negative regulation of viral genome replication	IBA	biological process
GO:0035455	response to interferon-alpha	IBA	biological process
GO:0034341	response to interferon-gamma	IBA	biological process
GO:0046597	negative regulation of viral entry into host cell	IBA	biological process
GO:0035456	response to interferon-beta	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0035455	response to interferon-alpha	IDA	biological process
GO:0034341	response to interferon-gamma	IDA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0046597	negative regulation of viral entry into host cell	IDA	biological process
GO:0035456	response to interferon-beta	IDA	biological process
GO:0045669	positive regulation of osteoblast differentiation	IMP	biological process
GO:0045071	negative regulation of viral genome replication	IMP	biological process
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0001503	ossification	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04662	B cell receptor signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R