• Gene id: 8513

Gene Summary

• Gene Symbol: LIPF   Gene   UCSC   Ensembl
• Aliases: GL, HGL, HLAL
• Gene name: lipase F, gastric type
• Alternate names: gastric triacylglycerol lipase, gastric lipase, lipase, gastric,
• Gene location: 10q23.31 (88664441: 88678814)     Exons: 11     NC_000010.11
• Gene summary(Entrez): This gene encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa
• OMIM: 601980

Protein Summary

• Protein general information: P07098  
  • Name: Gastric triacylglycerol lipase (GL) (Gastric lipase) (EC 3.1.1.3)
  • Length: 398  
  • Mass: 45238
• Sequence:

  MWLLLTMASLISVLGTTHGLFGKLHPGSPEVTMNISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTG
  QRPVVFLQHGLLASATNWISNLPNNSLAFILADAGYDVWLGNSRGNTWARRNLYYSPDSVEFWAFSFDEMAKYDL
  PATIDFIVKKTGQKQLHYVGHSQGTTIGFIAFSTNPSLAKRIKTFYALAPVATVKYTKSLINKLRFVPQSLFKFI
  FGDKIFYPHNFFDQFLATEVCSREMLNLLCSNALFIICGFDSKNFNTSRLDVYLSHNPAGTSVQNMFHWTQAVKS
  GKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDF
  IWAMDAPQEVYNDIVSMISEDKK

• Structural information:
  • Protein Domains: (78..37-)
    (/note="AB-hydrolase-1)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR029058  IPR000073  IPR039097  IPR025483  
  • Prosite: PS00120
  • PDB: 1HLG
  • PDBsum: 1HLG
  • STRING: ENSP00000377900
• Other Databases: GeneCards:  LIPF  Malacards:  LIPF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0004806	triglyceride lipase activity	IDA	molecular function
GO:0004806	triglyceride lipase activity	IDA	molecular function
GO:0016788	hydrolase activity, acting on ester bonds	IEA	molecular function
GO:0004806	triglyceride lipase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016042	lipid catabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0004806	triglyceride lipase activity	IEA	molecular function
GO:0016615	malate dehydrogenase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0006108	malate metabolic process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0008289	lipid binding	NAS	molecular function
GO:0004806	triglyceride lipase activity	TAS	molecular function
GO:0006641	triglyceride metabolic process	NAS	biological process
GO:0005575	cellular_component	ND	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00561	Glycerolipid metabolism
hsa04975	Fat digestion and absorption

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray