• Gene id: 8510

Gene Summary

• Gene Symbol: MMP23B   Gene   UCSC   Ensembl
• Aliases: MIFR, MIFR-1, MMP22, MMP23A
• Gene name: matrix metallopeptidase 23B
• Alternate names: matrix metalloproteinase-23, MMP-21, MMP-22, MMP-23, femalysin, matrix metalloproteinase 22, matrix metalloproteinase 23B, matrix metalloproteinase in the female reproductive tract, matrix metalloproteinase-21,
• Gene location: 1p36.33 (1631680: 1635637)     Exons: 8     NC_000001.11
• Gene summary(Entrez): This gene (MMP23B) encodes a member of the matrix metalloproteinase (MMP) family, and it is part of a duplicated region of chromosome 1p36.3. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in no
• OMIM: 603321

Protein Summary

• Protein general information: O75900  
  • Name: Matrix metalloproteinase 23 (MMP 23) (EC 3.4.24. ) (Femalysin) (MIFR 1) (Matrix metalloproteinase 21) (MMP 21) (Matrix metalloproteinase 22) (MMP 22) [Cleaved into: Matrix metalloproteinase 23, soluble form]
  • Length: 390  
  • Mass: 43935
  • Tissue specificity: Predominantly expressed in ovary, testis and prostate. {ECO
• Sequence:

  MGRGARVPSEAPGAGVERRWLGAALVALCLLPALVLLARLGAPAVPAWSAAQGDVAALGLSAVPPTRVPGPLAPR
  RRRYTLTPARLRWDHFNLTYRILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYPINHT
  DCLVSALHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTDLVHVAAHEIGHALGLMHSQHG
  RALMHLNATLRGWKALSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATT
  PPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTYTCVVRRQ
  QRVLTTYSWRVRVRG

• Structural information:
  • Protein Domains: (255..28-)
    (/note="ShKT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01005-)
    (295..38-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR033739   IPR024079  IPR028687  IPR001818  IPR021190  IPR006026  IPR003582  
  • Prosite: PS50835 PS51670 PS00142
  • CDD: cd04278
  • STRING: ENSP00000348308
• Other Databases: GeneCards:  MMP23B  Malacards:  MMP23B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0030574	collagen catabolic process	IBA	biological process
GO:0030198	extracellular matrix organization	IBA	biological process
GO:0004222	metalloendopeptidase activity	IBA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0031012	extracellular matrix	IEA	cellular component
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0006508	proteolysis	IDA	biological process
GO:0004222	metalloendopeptidase activity	IDA	molecular function
GO:0000003	reproduction	IEP	biological process
GO:0008237	metallopeptidase activity	NAS	molecular function
GO:0004222	metalloendopeptidase activity	NAS	molecular function
GO:0008270	zinc ion binding	NAS	molecular function
GO:0031012	extracellular matrix	NAS	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)