Male Infertility Database

Search Result

Gene id

8503

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

PIK3R3 Gene UCSC Ensembl

Aliases

p55, p55-GAMMA, p55PIK

Gene name

phosphoinositide-3-kinase regulatory subunit 3

Alternate names

phosphatidylinositol 3-kinase regulatory subunit gamma, PI3-kinase regulatory subunit gamma, PI3-kinase subunit p55-gamma, PI3K regulatory subunit gamma, phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma, phosphatidylinositol 3-kinase, regulatory s,

Gene location

1p34.1 (46174900: 46040139) Exons: 14 NC_000001.11

Gene summary(Entrez)

Phosphatidylinositol 3-kinase (PI3K) phosphorylates phosphatidylinositol and similar compounds, which then serve as second messengers in growth signaling pathways. PI3K is composed of a catalytic and a regulatory subunit. The protein encoded by this gene

OMIM

606076

Protein Summary

Protein general information

Q92569

Name: Phosphatidylinositol 3 kinase regulatory subunit gamma (PI3 kinase regulatory subunit gamma) (PI3K regulatory subunit gamma) (PtdIns 3 kinase regulatory subunit gamma) (Phosphatidylinositol 3 kinase 55 kDa regulatory subunit gamma) (PI3 kinase subunit p55

Length: 461 Mass: 54448

Tissue specificity: Highest levels in brain and testis. Lower levels in adipose tissue, kidney, heart, lung and skeletal muscle.

Sequence

MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVPNGMKDSSVSLQDAEWYWGDISREEV
NDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHYHHESLAQYNP
KLDVKLMYPVSRYQQDQLVKEDNIDAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKI
FEEQCHTQEQHSKEYIERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKNQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDADENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGK
PDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVRLAY
PVHAQMPSLCR

Structural information

Protein Domains	(65..16-) (/note="SH2-1) (/evidence="ECO:0000255\|PROSITE-ProRule:PRU00191-) (358..45-) (/note="SH2-2) (/evidence="ECO:0000255\|PROSITE-ProRule:PRU00191"-)
Interpro:	IPR032498 IPR035020 IPR035022 IPR000980 IPR036860
Prosite:	PS50001
CDD:	cd09930 cd09942
DIP:	30925
MINT:
STRING:	ENSP00000262741

Other Databases

GeneCards: PIK3R3 Malacards: PIK3R3

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0030335	positive regulation of ce ll migration	NAS	biological process
GO:0005942	phosphatidylinositol 3-ki nase complex	IBA	cellular component
GO:0008286	insulin receptor signalin g pathway	IBA	biological process
GO:0043551	regulation of phosphatidy linositol 3-kinase activi ty	IBA	biological process
GO:0046935	1-phosphatidylinositol-3- kinase regulator activity	IBA	molecular function
GO:0046854	phosphatidylinositol phos phorylation	IBA	biological process
GO:0016303	1-phosphatidylinositol-3- kinase activity	TAS	molecular function
GO:0008286	insulin receptor signalin g pathway	TAS	biological process
GO:0006661	phosphatidylinositol bios ynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043491	protein kinase B signalin g	IMP	biological process
GO:0010628	positive regulation of ge ne expression	IMP	biological process
GO:0002042	cell migration involved i n sprouting angiogenesis	IGI	biological process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological process
GO:0036092	phosphatidylinositol-3-ph osphate biosynthetic proc ess	IEA	biological process
GO:0001784	phosphotyrosine residue b inding	IPI	molecular function

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05168	Herpes simplex virus 1 infection
hsa05010	Alzheimer disease
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa05206	MicroRNAs in cancer
hsa05131	Shigellosis
hsa04014	Ras signaling pathway
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa04024	cAMP signaling pathway
hsa05166	Human T-cell leukemia virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa04510	Focal adhesion
hsa04360	Axon guidance
hsa05170	Human immunodeficiency virus 1 infection
hsa05203	Viral carcinogenesis
hsa05205	Proteoglycans in cancer
hsa05169	Epstein-Barr virus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04150	mTOR signaling pathway
hsa05225	Hepatocellular carcinoma
hsa05017	Spinocerebellar ataxia
hsa04072	Phospholipase D signaling pathway
hsa04140	Autophagy - animal
hsa04932	Non-alcoholic fatty liver disease
hsa04630	JAK-STAT signaling pathway
hsa05164	Influenza A
hsa04910	Insulin signaling pathway
hsa05226	Gastric cancer
hsa04218	Cellular senescence
hsa05161	Hepatitis B
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04380	Osteoclast differentiation
hsa05160	Hepatitis C
hsa05418	Fluid shear stress and atherosclerosis
hsa05135	Yersinia infection
hsa04611	Platelet activation
hsa04210	Apoptosis
hsa04926	Relaxin signaling pathway
hsa04722	Neurotrophin signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04725	Cholinergic synapse
hsa04152	AMPK signaling pathway
hsa04068	FoxO signaling pathway
hsa04670	Leukocyte transendothelial migration
hsa04070	Phosphatidylinositol signaling system
hsa04935	Growth hormone synthesis, secretion and action
hsa05162	Measles
hsa04919	Thyroid hormone signaling pathway
hsa04915	Estrogen signaling pathway
hsa04650	Natural killer cell mediated cytotoxicity
hsa05231	Choline metabolism in cancer
hsa04668	TNF signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04931	Insulin resistance
hsa04666	Fc gamma R-mediated phagocytosis
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04620	Toll-like receptor signaling pathway
hsa04066	HIF-1 signaling pathway
hsa04662	B cell receptor signaling pathway
hsa04914	Progesterone-mediated oocyte maturation
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05142	Chagas disease
hsa05222	Small cell lung cancer
hsa04012	ErbB signaling pathway
hsa04211	Longevity regulating pathway
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa01522	Endocrine resistance
hsa05146	Amoebiasis
hsa05100	Bacterial invasion of epithelial cells
hsa05210	Colorectal cancer
hsa05220	Chronic myeloid leukemia
hsa05215	Prostate cancer
hsa05214	Glioma
hsa04664	Fc epsilon RI signaling pathway
hsa05212	Pancreatic cancer
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa04917	Prolactin signaling pathway
hsa05221	Acute myeloid leukemia
hsa05211	Renal cell carcinoma
hsa05218	Melanoma
hsa05223	Non-small cell lung cancer
hsa04929	GnRH secretion
hsa04213	Longevity regulating pathway - multiple species
hsa04930	Type II diabetes mellitus
hsa04370	VEGF signaling pathway
hsa05213	Endometrial cancer
hsa04923	Regulation of lipolysis in adipocytes
hsa05230	Central carbon metabolism in cancer
hsa01524	Platinum drug resistance
hsa04973	Carbohydrate digestion and absorption
hsa04960	Aldosterone-regulated sodium reabsorption

Diseases

Expand All | Collapse All

Associated diseases	References
colon adenocarcinoma	PMID:24632606
Malignant glioma	PMID:28260020
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

Expand All | Collapse All

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
17327269	Teratozoos permia			19 (6 controls , 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
31037746	Spermatoge nic defect s			28 men with az oospermia	Male infertility	Microarray	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All