• Gene id: 8502

Gene Summary

• Gene Symbol: PKP4   Gene   UCSC   Ensembl
• Aliases: p0071
• Gene name: plakophilin 4
• Alternate names: plakophilin-4, catenin 4,
• Gene location: 2q24.1 (158456951: 158681428)     Exons: 28     NC_000002.12
• Gene summary(Entrez): Armadillo-like proteins are characterized by a series of armadillo repeats, first defined in the Drosophila 'armadillo' gene product, that are typically 42 to 45 amino acids in length. These proteins can be divided into subfamilies based on their number o
• OMIM: 604276

Protein Summary

• Protein general information: Q99569  
  • Name: Plakophilin 4 (p0071)
  • Length: 1192  
  • Mass: 131868
• Sequence:

  MPAPEQASLVEEGQPQTRQEAASTGPGMEPETTATTILASVKEQELQFQRLTRELEVERQIVASQLERCRLGAES
  PSIASTSSTEKSFPWRSTDVPNTGVSKPRVSDAVQPNNYLIRTEPEQGTLYSPEQTSLHESEGSLGNSRSSTQMN
  SYSDSGYQEAGSFHNSQNVSKADNRQQHSFIGSTNNHVVRNSRAEGQTLVQPSVANRAMRRVSSVPSRAQSPSYV
  ISTGVSPSRGSLRTSLGSGFGSPSVTDPRPLNPSAYSSTTLPAARAASPYSQRPASPTAIRRIGSVTSRQTSNPN
  GPTPQYQTTARVGSPLTLTDAQTRVASPSQGQVGSSSPKRSGMTAVPQHLGPSLQRTVHDMEQFGQQQYDIYERM
  VPPRPDSLTGLRSSYASQHSQLGQDLRSAVSPDLHITPIYEGRTYYSPVYRSPNHGTVELQGSQTALYRTGSVGI
  GNLQRTSSQRSTLTYQRNNYALNTTATYAEPYRPIQYRVQECNYNRLQHAVPADDGTTRSPSIDSIQKDPREFAW
  RDPELPEVIHMLQHQFPSVQANAAAYLQHLCFGDNKVKMEVCRLGGIKHLVDLLDHRVLEVQKNACGALRNLVFG
  KSTDENKIAMKNVGGIPALLRLLRKSIDAEVRELVTGVLWNLSSCDAVKMTIIRDALSTLTNTVIVPHSGWNNSS
  FDDDHKIKFQTSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDSLLYVIHTCVNTSDYDSKTVENCVCTLRNLS
  YRLELEVPQARLLGLNELDDLLGKESPSKDSEPSCWGKKKKKKKRTPQEDQWDGVGPIPGLSKSPKGVEMLWHPS
  VVKPYLTLLAESSNPATLEGSAGSLQNLSAGNWKFAAYIRAAVRKEKGLPILVELLRMDNDRVVSSVATALRNMA
  LDVRNKELIGKYAMRDLVNRLPGGNGPSVLSDETMAAICCALHEVTSKNMENAKALADSGGIEKLVNITKGRGDR
  SSLKVVKAAAQVLNTLWQYRDLRSIYKKDGWNQNHFITPVSTLERDRFKSHPSLSTTNQQMSPIIQSVGSTSSSP
  ALLGIRDPRSEYDRTQPPMQYYNSQGDATHKGLYPGSSKPSPIYISSYSSPAREQNRRLQHQQLYYSQDDSNRKN
  FDAYRLYLQSPHSYEDPYFDDRVHFPASTDYSTQYGLKSTTNYVDFYSTKRPSYRAEQYPGSPDSWV

• Structural information:
  • Interpro: IPR011989  IPR016024  IPR000225  IPR028443  IPR028435  
  • Prosite: PS50176
  • STRING: ENSP00000374409
• Other Databases: GeneCards:  PKP4  Malacards:  PKP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0098609	cell-cell adhesion	IBA	biological process
GO:0045296	cadherin binding	IBA	molecular function
GO:0005912	adherens junction	IBA	cellular component
GO:0005911	cell-cell junction	IBA	cellular component
GO:0007043	cell-cell junction assembly	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0009898	cytoplasmic side of plasma membrane	IDA	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0051233	spindle midzone	IDA	cellular component
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0030496	midbody	IDA	cellular component
GO:0000922	spindle pole	IDA	cellular component
GO:0032467	positive regulation of cytokinesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0032467	positive regulation of cytokinesis	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0001533	cornified envelope	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0031424	keratinization	TAS	biological process
GO:0070268	cornification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0014069	postsynaptic density	IEA	cellular component
GO:0007043	cell-cell junction assembly	IEA	biological process
GO:0030057	desmosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0030057	desmosome	IDA	cellular component
GO:0005911	cell-cell junction	IDA	cellular component
GO:0044291	cell-cell contact zone	IDA	colocalizes with
GO:0030496	midbody	IDA	colocalizes with
GO:0005886	plasma membrane	IDA	cellular component
GO:0005856	cytoskeleton	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030155	regulation of cell adhesion	NAS	biological process
GO:0007267	cell-cell signaling	NAS	biological process
GO:0007043	cell-cell junction assembly	ISS	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)