• Gene id: 85012

Gene Summary

• Gene Symbol: TCEAL3   Gene   UCSC   Ensembl
• Aliases: WEX8
• Gene name: transcription elongation factor A like 3
• Alternate names: transcription elongation factor A protein-like 3, TCEA-like protein 3, transcription elongation factor A (SII)-like 3, transcription elongation factor S-II protein-like 3,
• Gene location: Xq22.2 (103607905: 103609926)     Exons: 3     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner.
• OMIM: 604879

Protein Summary

• Protein general information: Q969E4  
  • Name: Transcription elongation factor A protein like 3 (TCEA like protein 3) (Transcription elongation factor S II protein like 3)
  • Length: 200  
  • Mass: 22502
• Sequence:

  MEKPYNKNEGNLENEGKPEDEVEPDDEGKSDEEEKPDVEGKTECEGKREDEGEPGDEGQLEDEGSQEKQGRSEGE
  GKPQGEGKPASQAKPESQPRAAEKRPAEDYVPRKAKRKTDRGTDDSPKDSQEDLQERHLSSEEMMRECGDVSRAQ
  EELRKKQKMGGFHWMQRDVQDPFAPRGQRGVRGVRGGGRGQRGLHDIPYL

• Structural information:
  • Interpro: IPR021156  
  • STRING: ENSP00000361711
• Other Databases: GeneCards:  TCEAL3  Malacards:  TCEAL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0050699	WW domain binding	IBA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881