• Gene id: 8501

Gene Summary

• Gene Symbol: SLC43A1   Gene   UCSC   Ensembl
• Aliases: LAT3, PB39, POV1, R00504
• Gene name: solute carrier family 43 member 1
• Alternate names: large neutral amino acids transporter small subunit 3, L-type amino acid transporter 3, prostate cancer overexpressed gene 1 protein, solute carrier family 43 (amino acid system L transporter), member 1,
• Gene location: 11q12.1 (57516560: 57484530)     Exons: 18     NC_000011.10
• Gene summary(Entrez): SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids (Babu et al., 2003 [PubMed 12930836]).[supplied by OMIM, Mar 2008]
• OMIM: 605767

Protein Summary

• Protein general information: O75387  
  • Name: Large neutral amino acids transporter small subunit 3 (L type amino acid transporter 3) (Prostate cancer overexpressed gene 1 protein) (Solute carrier family 43 member 1)
  • Length: 559  
  • Mass: 61477
  • Tissue specificity: In adults, found in all tissues examined with highest expression in pancreas. In fetus, highest expression in liver and lower levels in kidney, and lung. High levels found in prostate cancer cells. {ECO
• Sequence:

  MAPTLQQAYRRRWWMACTAVLENLFFSAVLLGWGSLLIILKNEGFYSSTCPAESSTNTTQDEQRRWPGCDQQDEM
  LNLGFTIGSFVLSATTLPLGILMDRFGPRPVRLVGSACFTASCTLMALASRDVEALSPLIFLALSLNGFGGICLT
  FTSLTLPNMFGNLRSTLMALMIGSYASSAITFPGIKLIYDAGVAFVVIMFTWSGLACLIFLNCTLNWPIEAFPAP
  EEVNYTKKIKLSGLALDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRKSLC
  SPTFLWSLLTMGMTQLRIIFYMAAVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFGAMQLLCLLTCPLIGY
  IMDWRIKDCVDAPTQGTVLGDARDGVATKSIRPRYCKIQKLTNAISAFTLTNLLLVGFGITCLINNLHLQFVTFV
  LHTIVRGFFHSACGSLYAAVFPSNHFGTLTGLQSLISAVFALLQQPLFMAMVGPLKGEPFWVNLGLLLFSLLGFL
  LPSYLFYYRARLQQEYAANGMGPLKVLSGSEVTA

• Structural information:
  • Interpro: IPR011701  IPR036259  
  • DIP: 47272
  • STRING: ENSP00000278426
• Other Databases: GeneCards:  SLC43A1  Malacards:  SLC43A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015804	neutral amino acid transport	IBA	biological process
GO:0015179	L-amino acid transmembrane transporter activity	IBA	molecular function
GO:0015175	neutral amino acid transmembrane transporter activity	IBA	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0006865	amino acid transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0015171	amino acid transmembrane transporter activity	TAS	molecular function
GO:0006865	amino acid transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:1902475	L-alpha-amino acid transmembrane transport	IEA	biological process
GO:0003333	amino acid transmembrane transport	IEA	biological process
GO:0015804	neutral amino acid transport	IDA	biological process
GO:0015175	neutral amino acid transmembrane transporter activity	IDA	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881