• Gene id: 84992

Gene Summary

• Gene Symbol: PIGY   Gene   UCSC   Ensembl
• Aliases: HPMRS6, PIG-Y
• Gene name: phosphatidylinositol glycan anchor biosynthesis class Y
• Alternate names: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y, phosphatidylinositol-glycan biosynthesis class Y protein,
• Gene location: 4q22.1 (88523800: 88520977)     Exons: 2     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is part of the GPI-N-acetylglucosaminyltransferase (GIP-GnT) complex which initiates the biosynthesis of glycosylphosphatidylinositol (GPI). GPI is synthesized in the endoplasmic reticulum and serves as an anchor for many
• OMIM: 300553

Protein Summary

• Protein general information: Q3MUY2  
  • Name: Phosphatidylinositol N acetylglucosaminyltransferase subunit Y (Phosphatidylinositol glycan biosynthesis class Y protein) (PIG Y)
  • Length: 71  
  • Mass: 8058
• Sequence:

  MFLSLPTLTVLIPLVSLAGLFYSASVEENFPQGCTSTASLCFYSLLLPITIPVYVFFHLWTWMGIKLFRHN

• Structural information:
  • Interpro: IPR029164  IPR033535  
  • STRING: ENSP00000432688
• Other Databases: GeneCards:  PIGY  Malacards:  PIGY

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006506	GPI anchor biosynthetic process	IBA	biological process
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0000506	glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex	IBA	cellular component
GO:0006506	GPI anchor biosynthetic process	IEA	biological process
GO:0000506	glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex	IEA	cellular component
GO:0006506	GPI anchor biosynthetic process	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006506	GPI anchor biosynthetic process	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0000506	glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0016254	preassembly of GPI anchor in ER membrane	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0017176	phosphatidylinositol N-acetylglucosaminyltransferase activity	IDA	contributes to
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0006506	GPI anchor biosynthetic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00563	Glycosylphosphatidylinositol

Diseases

Associated diseases	References
Inherited glycosylphosphatidylinositol deficiencies	KEGG:H01489
Hyperphosphatasia with mental retardation syndrome	KEGG:H01488
Inherited glycosylphosphatidylinositol deficiencies	KEGG:H01489
Hyperphosphatasia with mental retardation syndrome	KEGG:H01488
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881