About Us

Search Result


Gene id 84988
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol PPP1R16A   Gene   UCSC   Ensembl
Aliases MYPT3
Gene name protein phosphatase 1 regulatory subunit 16A
Alternate names protein phosphatase 1 regulatory subunit 16A, myosin phosphatase-targeting subunit 3, protein phosphatase 1, regulatory (inhibitor) subunit 16A,
Gene location 8q24.3 (144477981: 144502120)     Exons: 15     NC_000008.11
Gene summary(Entrez) Myosin light chain kinase and phosphatase (MLCP) complexes control the phosphorylation states of regulatory myosin light chains, which is crucial for muscle and intracellular movement. MLCPs typically contain a catalytic protein phosphatase 1 (PP1c) subun
OMIM 616458

Protein Summary

Protein general information Q96I34  

Name: Protein phosphatase 1 regulatory subunit 16A (Myosin phosphatase targeting subunit 3)

Length: 528  Mass: 57811

Sequence MAEHLELLAEMPMVGRMSTQERLKHAQKRRAQQVKMWAQAEKEAQGKKGPGERPRKEAASQGLLKQVLFPPSVVL
LEAAARNDLEEVRQFLGSGVSPDLANEDGLTALHQCCIDDFREMVQQLLEAGANINACDSECWTPLHAAATCGHL
HLVELLIASGANLLAVNTDGNMPYDLCDDEQTLDCLETAMADRGITQDSIEAARAVPELRMLDDIRSRLQAGADL
HAPLDHGATLLHVAAANGFSEAAALLLEHRASLSAKDQDGWEPLHAAAYWGQVPLVELLVAHGADLNAKSLMDET
PLDVCGDEEVRAKLLELKHKHDALLRAQSRQRSLLRRRTSSAGSRGKVVRRVSLTQRTDLYRKQHAQEAIVWQQP
PPTSPEPPEDNDDRQTGAELRPPPPEEDNPEVVRPHNGRVGGSPVRHLYSKRLDRSVSYQLSPLDSTTPHTLVHD
KAHHTLADLKRQRAAAKLQRPPPEGPESPETAEPGLPGDTVTPQPDCGFRAGGDPPLLKLTAPAVEAPVERRPCC
LLM
Structural information
Interpro:  IPR002110  IPR020683  IPR036770  IPR017417  
Prosite:   PS50297 PS50088
MINT:  
STRING:   ENSP00000292539
Other Databases GeneCards:  PPP1R16A  Malacards:  PPP1R16A

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005886 plasma membrane
IBA cellular component
GO:0017020 myosin phosphatase regula
tor activity
IBA molecular function
GO:0019888 protein phosphatase regul
ator activity
IBA molecular function
GO:0008157 protein phosphatase 1 bin
ding
IBA molecular function
GO:0035304 regulation of protein dep
hosphorylation
IBA biological process
GO:0019888 protein phosphatase regul
ator activity
IEA molecular function
GO:0016020 membrane
IEA cellular component
GO:0005886 plasma membrane
IEA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005886 plasma membrane
IEA cellular component
GO:0043666 regulation of phosphoprot
ein phosphatase activity
IEA biological process
GO:0043666 regulation of phosphoprot
ein phosphatase activity
IEA biological process
GO:0043666 regulation of phosphoprot
ein phosphatase activity
IEA biological process
GO:0005886 plasma membrane
IBA cellular component
GO:0017020 myosin phosphatase regula
tor activity
IBA molecular function
GO:0019888 protein phosphatase regul
ator activity
IBA molecular function
GO:0008157 protein phosphatase 1 bin
ding
IBA molecular function
GO:0035304 regulation of protein dep
hosphorylation
IBA biological process
GO:0019888 protein phosphatase regul
ator activity
IEA molecular function
GO:0016020 membrane
IEA cellular component
GO:0005886 plasma membrane
IEA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005886 plasma membrane
IEA cellular component
GO:0043666 regulation of phosphoprot
ein phosphatase activity
IEA biological process
GO:0043666 regulation of phosphoprot
ein phosphatase activity
IEA biological process
GO:0043666 regulation of phosphoprot
ein phosphatase activity
IEA biological process
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Hypospermatogenesis MIK: 28361989

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
28361989 Hyposperma
togenesis

6 (3 controls,
3 Klienfelter s
yndrome
Male infertility Microarray
Show abstract