• Gene id: 84986

Gene Summary

• Gene Symbol: ARHGAP19   Gene   UCSC   Ensembl
• Gene name: Rho GTPase activating protein 19
• Alternate names: rho GTPase-activating protein 19, putative RhoGAP protein, rho-type GTPase-activating protein 19,
• Gene location: 10q24.1 (97292672: 97222172)     Exons: 16     NC_000010.11
• Gene summary(Entrez): Members of the ARHGAP family, such as ARHGAP19, encode negative regulators of Rho GTPases (see RHOA; MIM 165390), which are involved in cell migration, proliferation, and differentiation, actin remodeling, and G1 cell cycle progression (Lv et al., 2007 [P
• OMIM: 611587

Protein Summary

• Protein general information: Q14CB8  
  • Name: Rho GTPase activating protein 19 (Rho type GTPase activating protein 19)
  • Length: 494  
  • Mass: 55756
  • Tissue specificity: Strong expression in fetal heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Weak expression in adult pancreas, spleen, thymus, and ovary. {ECO
• Sequence:

  MATEAQSEGEVPARESGRSDAICSFVICNDSSLRGQPIIFNPDFFVEKLRHEKPEIFTELVVSNITRLIDLPGTE
  LAQLMGEVDLKLPGGAGPASGFFRSLMSLKRKEKGVIFGSPLTEEGIAQIYQLIEYLHKNLRVEGLFRVPGNSVR
  QQILRDALNNGTDIDLESGEFHSNDVATLLKMFLGELPEPLLTHKHFNAHLKIADLMQFDDKGNKTNIPDKDRQI
  EALQLLFLILPPPNRNLLKLLLDLLYQTAKKQDKNKMSAYNLALMFAPHVLWPKNVTANDLQENITKLNSGMAFM
  IKHSQKLFKAPAYIRECARLHYLGSRTQASKDDLDLIASCHTKSFQLAKSQKRNRVDSCPHQEETQHHTEEALRE
  LFQHVHDMPESAKKKQLIRQFNKQSLTQTPGREPSTSQVQKRARSRSFSGLIKRKVLGNQMMSEKKKKNPTPESV
  AIGELKGTSKENRNLLFSGSPAVTMTPTRLKWSEGKKEGKKGFL

• Structural information:
  • Protein Domains: (102..30-)
    (/note="Rho-GAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00172"-)
  • Interpro: IPR008936  IPR000198  
  • Prosite: PS50238
  • STRING: ENSP00000351333
• Other Databases: GeneCards:  ARHGAP19  Malacards:  ARHGAP19

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051056	regulation of small GTPase mediated signal transduction	IBA	biological process
GO:0005096	GTPase activator activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)