• Gene id: 8498

Gene Summary

• Gene Symbol: RANBP3   Gene   UCSC   Ensembl
• Gene name: RAN binding protein 3
• Alternate names: ran-binding protein 3, epididymis secretory sperm binding protein,
• Gene location: 19p13.3 (5978139: 5916138)     Exons: 19     NC_000019.10
• Gene summary(Entrez): This gene encodes a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex. Alternate transcriptional splice variants, encoding different isoforms, have be
• OMIM: 603327

Protein Summary

• Protein general information: Q9H6Z4  
  • Name: Ran binding protein 3 (RanBP3)
  • Length: 567  
  • Mass: 60210
  • Tissue specificity: Widely expressed with high levels in testis and heart. {ECO
• Sequence:

  MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHHGTGHPESAGEHALEPPAPAGASAST
  PPPPAPEAQLPPFPRELAGRSAGGSSPEGGEDSDREDGNYCPPVKRERTSSLTQFPPSQSEERSSGFRLKPPTLI
  HGQAPSAGLPSQKPKEQQRSVLRPAVLQAPQPKALSQTVPSSGTNGVSLPADCTGAVPAASPDTAAWRSPSEAAD
  EVCALEEKEPQKNESSNASEEEACEKKDPATQQAFVFGQNLRDRVKLINESVDEADMENAGHPSADTPTATNYFL
  QYISSSLENSTNSADASSNKFVFGQNMSERVLSPPKLNEVSSDANRENAAAESGSESSSQEATPEKESLAESAAA
  YTKATARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWVERGRGLLRLNDMASTDDGTLQSRLVMRTQGS
  LRLILNTKLWAQMQIDKASEKSIRITAMDTEDQGVKVFLISASSKDTGQLYAALHHRILALRSRVEQEQEAKMPA
  PEPGAAPSNEEDDSDDDDVLAPSGATAAGAGDEGDGQTTGST

• Structural information:
  • Protein Domains: (378..51-)
    (/note="RanBD1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00164"-)
  • Interpro: IPR011993  IPR000156  
  • Prosite: PS50196
  • PDB: 2CRF 2Y8F 2Y8G 5XZX
  • PDBsum: 2CRF 2Y8F 2Y8G 5XZX
  • STRING: ENSP00000341483
• Other Databases: GeneCards:  RANBP3  Malacards:  RANBP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005096	GTPase activator activity	IBA	contributes to
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0008536	Ran GTPase binding	IBA	molecular function
GO:0005643	nuclear pore	IBA	cellular component
GO:0006611	protein export from nucleus	IBA	biological process
GO:0070412	R-SMAD binding	IPI	molecular function
GO:0070412	R-SMAD binding	IPI	molecular function
GO:0046907	intracellular transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05166	Human T-cell leukemia virus 1 infection

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray