• Gene id: 84978

Gene Summary

• Gene Symbol: FRMD5   Gene   UCSC   Ensembl
• Gene name: FERM domain containing 5
• Alternate names: FERM domain-containing protein 5,
• Gene location: 15q15.3 (44195270: 43870763)     Exons: 19     NC_000015.10
• OMIM: 607784

Protein Summary

• Protein general information: Q7Z6J6  
  • Name: FERM domain containing protein 5
  • Length: 570  
  • Mass: 65065
• Sequence:

  MLSRLMSGSSRSLEREYSCTVRLLDDSEYTCTIQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFT
  KSVVKQLRSQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDS
  GKHPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFT
  PFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFYLYVSQKEEKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSS
  QVRTVSSSNLFFKGSRFRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSRSCPSITHGPRLSSVPRTRRRAVHIS
  IMEGLESLRDSAHSTPVRSTSHGDTFLPHVRSSRTDSNERVAVIADEAYSPADSVLPTPVAEHSLELMLLSRQIN
  GATCSIEEEKESEASTPTATEVEALGGELRALCQGHSGPEEEQVNKFVLSVLRLLLVTMGLLFVLLLLLIILTES
  DLDIAFFRDIRQTPEFEQFHYQYFCPLRRWFACKIRSVVSLLIDT

• Structural information:
  • Protein Domains: (17..29-)
    (/note="FERM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00084"-)
  • Interpro: IPR019749  IPR000798  IPR014847  IPR014352  IPR035963   IPR019748  IPR019747  IPR000299  IPR018979  IPR018980  IPR011993  IPR029071  
  • Prosite: PS00660 PS50057
  • CDD: cd14473
  • STRING: ENSP00000403067
• Other Databases: GeneCards:  FRMD5  Malacards:  FRMD5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031032	actomyosin structure organization	IBA	biological process
GO:0005856	cytoskeleton	IBA	cellular component
GO:0005912	adherens junction	IDA	cellular component
GO:0005178	integrin binding	IDA	molecular function
GO:0019901	protein kinase binding	IDA	molecular function
GO:0030334	regulation of cell migration	IMP	biological process
GO:2000146	negative regulation of cell motility	IMP	biological process
GO:0045785	positive regulation of cell adhesion	IMP	biological process
GO:0008092	cytoskeletal protein binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005912	adherens junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq