• Gene id: 84962

Gene Summary

• Gene Symbol: AJUBA   Gene   UCSC   Ensembl
• Aliases: JUB
• Gene name: ajuba LIM protein
• Alternate names: LIM domain-containing protein ajuba, jub, ajuba homolog,
• Gene location: 14q11.2 (122553111: 122554213)     Exons: 1     NC_000009.12
• OMIM: 609066

Protein Summary

• Protein general information: Q96IF1  
  • Name: LIM domain containing protein ajuba
  • Length: 538  
  • Mass: 56934
• Sequence:

  MERLGEKASRLLEKFGRRKGESSRSGSDGTPGPGKGRLSGLGGPRKSGPRGATGGPGDEPLEPAREQGSLDAERN
  QRGSFEAPRYEGSFPAGPPPTRALPLPQSLPPDFRLEPTAPALSPRSSFASSSASDASKPSSPRGSLLLDGAGAG
  GAGGSRPCSNRTSGISMGYDQRHGSPLPAGPCLFGPPLAGAPAGYSPGGVPSAYPELHAALDRLYAQRPAGFGCQ
  ESRHSYPPALGSPGALAGAGVGAAGPLERRGAQPGRHSVTGYGDCAVGARYQDELTALLRLTVGTGGREAGARGE
  PSGIEPSGLEEPPGPFVPEAARARMREPEAREDYFGTCIKCNKGIYGQSNACQALDSLYHTQCFVCCSCGRTLRC
  KAFYSVNGSVYCEEDYLFSGFQEAAEKCCVCGHLILEKILQAMGKSYHPGCFRCIVCNKCLDGIPFTVDFSNQVY
  CVTDYHKNYAPKCAACGQPILPSEGCEDIVRVISMDRDYHFECYHCEDCRMQLSDEEGCCCFPLDGHLLCHGCHM
  QRLNARQPPANYI

• Structural information:
  • Protein Domains: (336..39-)
    1 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (401..46-)
    2 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (462..53-)
    3 (/note="LIM-zinc-binding)
    (/evidence="ECO-)
  • Interpro: IPR001781  
  • Prosite: PS00478 PS50023
  • STRING: ENSP00000262713
• Other Databases: GeneCards:  AJUBA  Malacards:  AJUBA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000637	positive regulation of gene silencing by miRNA	IBA	biological process
GO:0007010	cytoskeleton organization	IBA	biological process
GO:0005912	adherens junction	IBA	cellular component
GO:0005911	cell-cell junction	IBA	cellular component
GO:0001666	response to hypoxia	IBA	biological process
GO:0000932	P-body	IBA	cellular component
GO:0035331	negative regulation of hippo signaling	IBA	biological process
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:1900037	regulation of cellular response to hypoxia	IDA	biological process
GO:0001666	response to hypoxia	IDA	biological process
GO:0035331	negative regulation of hippo signaling	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0003714	transcription corepressor activity	IDA	molecular function
GO:2000637	positive regulation of gene silencing by miRNA	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0045294	alpha-catenin binding	IDA	molecular function
GO:0031334	positive regulation of protein-containing complex assembly	IDA	biological process
GO:0005911	cell-cell junction	IDA	cellular component
GO:0000932	P-body	IDA	cellular component
GO:0035195	gene silencing by miRNA	IMP	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005911	cell-cell junction	IEA	cellular component
GO:0003682	chromatin binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0030032	lamellipodium assembly	IEA	biological process
GO:0030334	regulation of cell migration	IEA	biological process
GO:0033674	positive regulation of kinase activity	IEA	biological process
GO:0035313	wound healing, spreading of epidermal cells	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0043406	positive regulation of MAP kinase activity	IEA	biological process
GO:0045294	alpha-catenin binding	IEA	molecular function
GO:0048041	focal adhesion assembly	IEA	biological process
GO:0051015	actin filament binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0016339	calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IEA	biological process
GO:0030027	lamellipodium	IEA	cellular component
GO:0031328	positive regulation of cellular biosynthetic process	IEA	biological process
GO:0033673	negative regulation of kinase activity	IEA	biological process
GO:0034613	cellular protein localization	IEA	biological process
GO:0043087	regulation of GTPase activity	IEA	biological process
GO:0046474	glycerophospholipid biosynthetic process	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0000932	P-body	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04390	Hippo signaling pathway
hsa04392	Hippo signaling pathway - multiple species

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray