• Gene id: 84959

Gene Summary

• Gene Symbol: UBASH3B   Gene   UCSC   Ensembl
• Aliases: STS-1, STS1, TULA-2, TULA2, p70
• Gene name: ubiquitin associated and SH3 domain containing B
• Alternate names: ubiquitin-associated and SH3 domain-containing protein B, Cbl-interacting protein Sts-1, SH3 domain-containing 70 kDa protein, suppressor of T-cell receptor signaling 1, nm23-phosphorylated unknown substrate, T-cell ubiquitin ligand 2, cbl-interacting protein,
• Gene location: 11q24.1 (122655721: 122814472)     Exons: 15     NC_000011.10
• Gene summary(Entrez): This gene encodes a protein that contains a ubiquitin associated domain at the N-terminus, an SH3 domain, and a C-terminal domain with similarities to the catalytic motif of phosphoglycerate mutase. The encoded protein was found to inhibit endocytosis of
• OMIM: 609201

Protein Summary

• Protein general information: Q8TF42  
  • Name: Ubiquitin associated and SH3 domain containing protein B (EC 3.1.3.48) (Cbl interacting protein p70) (Suppressor of T cell receptor signaling 1) (STS 1) (T cell ubiquitin ligand 2) (TULA 2) (Tyrosine protein phosphatase STS1/TULA2)
  • Length: 649  
  • Mass: 72696
• Sequence:

  MAQYGHPSPLGMAAREELYSKVTPRRNRQQRPGTIKHGSALDVLLSMGFPRARAQKALASTGGRSVQAACDWLFS
  HVGDPFLDDPLPREYVLYLRPTGPLAQKLSDFWQQSKQICGKNKAHNIFPHITLCQFFMCEDSKVDALGEALQTT
  VSRWKCKFSAPLPLELYTSSNFIGLFVKEDSAEVLKKFAADFAAEAASKTEVHVEPHKKQLHVTLAYHFQASHLP
  TLEKLAQNIDVKLGCDWVATIFSRDIRFANHETLQVIYPYTPQNDDELELVPGDFIFMSPMEQTSTSEGWIYGTS
  LTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERRPYEDQGLGETTPLTIICQPMQPLRV
  NSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQAR
  LVGEALLESNTIIDHVYCSPSLRCVQTAHNILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANL
  SVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQ
  MVRKIPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGFNWRETLLQE

• Structural information:
  • Protein Domains: (27..7-)
    (/note="UBA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00212-)
    (254..31-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192"-)
  • Interpro: IPR013078  IPR029033  IPR036028  IPR001452  IPR015940   IPR009060  IPR035632  
  • Prosite: PS50002 PS50030
  • CDD: cd07067 cd11936
  • PDB: 2CPW 2E5K 5VR6 5W5G
  • PDBsum: 2CPW 2E5K 5VR6 5W5G
  • STRING: ENSP00000284273
• Other Databases: GeneCards:  UBASH3B  Malacards:  UBASH3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0038063	collagen-activated tyrosine kinase receptor signaling pathway	IBA	biological process
GO:0009968	negative regulation of signal transduction	IBA	biological process
GO:0004725	protein tyrosine phosphatase activity	IBA	molecular function
GO:0070527	platelet aggregation	IBA	biological process
GO:0051279	regulation of release of sequestered calcium ion into cytosol	IBA	biological process
GO:0045779	negative regulation of bone resorption	IBA	biological process
GO:0045670	regulation of osteoclast differentiation	IBA	biological process
GO:0038065	collagen-activated signaling pathway	IBA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IBA	biological process
GO:0006469	negative regulation of protein kinase activity	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0030168	platelet activation	IEA	biological process
GO:0038063	collagen-activated tyrosine kinase receptor signaling pathway	IEA	biological process
GO:0045671	negative regulation of osteoclast differentiation	IEA	biological process
GO:0051219	phosphoprotein binding	IEA	molecular function
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0038065	collagen-activated signaling pathway	IEA	biological process
GO:0043393	regulation of protein binding	IEA	biological process
GO:0045670	regulation of osteoclast differentiation	IEA	biological process
GO:0045779	negative regulation of bone resorption	IEA	biological process
GO:0051279	regulation of release of sequestered calcium ion into cytosol	IEA	biological process
GO:0070527	platelet aggregation	IEA	biological process
GO:0090331	negative regulation of platelet aggregation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq