• Gene id: 84957

Gene Summary

• Gene Symbol: RELT   Gene   UCSC   Ensembl
• Aliases: AI3C, TNFRSF19L, TRLT
• Gene name: RELT TNF receptor
• Alternate names: tumor necrosis factor receptor superfamily member 19L, RELT tumor necrosis factor receptor, receptor expressed in lymphoid tissues,
• Gene location: 11q13.4 (73376394: 73397473)     Exons: 12     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is especially abundant in hematologic tissues. It has been shown to activate the NF-kappaB pathway and selectively bind TNF receptor-associated factor 1 (TRAF1). T
• OMIM: 614966

Protein Summary

• Protein general information: Q969Z4  
  • Name: Tumor necrosis factor receptor superfamily member 19L (Receptor expressed in lymphoid tissues)
  • Length: 430  
  • Mass: 46092
  • Tissue specificity: Spleen, lymph node, brain, breast and peripheral blood leukocytes (at protein level) (PubMed
• Sequence:

  MKPSLLCRPLSCFLMLLPWPLATLTSTTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWR
  RLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNG
  TRAGGPEETAAQYAVIAIVPVFCLMGLLGILVCNLLKRKGYHCTAHKEVGPGPGGGGSGINPAYRTEDANEDTIG
  VLVRLITEKKENAAALEELLKEYHSKQLVQTSHRPVSKLPPAPPNVPHICPHRHHLHTVQGLASLSGPCCSRCSQ
  KKWPEVLLSPEAVAATTPVPSLLPNPTRVPKAGAKAGRQGEITILSVGRFRVARIPEQRTSSMVSEVKTITEAGP
  SWGDLPDSPQPGLPPEQQALLGSGGSRTKWLKPPAENKAEENRYVVRLSESNLVI

• Structural information:
  • Interpro: IPR022248  IPR022333  IPR034048  
  • CDD: cd13419
  • STRING: ENSP00000064780
• Other Databases: GeneCards:  RELT  Malacards:  RELT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097186	amelogenesis	IBA	biological process
GO:0006915	apoptotic process	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006915	apoptotic process	IMP	biological process
GO:0006915	apoptotic process	IMP	biological process
GO:0097186	amelogenesis	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0097186	amelogenesis	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray