• Gene id: 84948

Gene Summary

• Gene Symbol: TIGD5   Gene   UCSC   Ensembl
• Gene name: tigger transposable element derived 5
• Alternate names: tigger transposable element-derived protein 5,
• Gene location: 8q24.3 (143597830: 143603223)     Exons: 1     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposa
• OMIM: 604025

Protein Summary

• Protein general information: Q53EQ6  
  • Name: Tigger transposable element derived protein 5
  • Length: 642  
  • Mass: 69222
• Sequence:

  MYPAGPPAGPVPRRGRRPLPGPPAPAPAPVPAARPPPPAPGPRPRVAVKMAFRKAYSIKDKLQAIERVKGGERQA
  SVCRDFGVPGGTLRGWLKDEPKLRWFLEQLGGEVGTQRKKMRLANEEEIDRAVYAWFLALRQHGVPLSGPLIQAQ
  AEAFARQIYGPECTFKASHGWFWRWQKRHGISSQRFYGEAGPPAPSPAPGPPVKEEPALPSGAGPLPDRAPAPPP
  PAEGGYGDEQIYSASVTGLYWKLLPEQAAPPGAGDPGAGGCGRRWRGDRVTVLLAANLTGSHKLKPLVIGRLPDP
  PSLRHHNQDKFPASYRYSPDAWLSRPLLRGWFFEEFVPGVKRYLRRSCLQQKAVLLVAHPPCPSPAASMPALDSE
  DAPVRCRPEPLGPPEELQTPDGAVRVLFLSKGSSRAHIPAPLEQGVVAAFKQLYKRELLRLAVSCASGSPLDFMR
  SFMLKDMLYLAGLSWDLVQAGSIERCWLLGLRAAFEPRPGEDSAGQPAQAEEAAEHSRVLSDLTHLAALAYKCLA
  PEEVAEWLHLDDDGGPPEGCREEVGPALPPAAPPAPASLPSAMGGGEDEEEATDYGGTSVPTAGEAVRGLETALR
  WLENQDPREVGPLRLVQLRSLISMARRLGGIGHTPAGPYDGV

• Structural information:
  • Protein Domains: (47..9-)
    (/note="HTH-psq-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00320-)
    (112..18-)
    (/note="HTH-CENPB-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00583-)
    (233..35-)
    (/note="DDE-1-1)
    (/evidence="ECO:0000255-)
    (410..-)
  • Interpro: IPR004875  IPR009057  IPR006600  IPR007889  IPR036388  
  • Prosite: PS51253 PS50960
  • STRING: ENSP00000421489
• Other Databases: GeneCards:  TIGD5  Malacards:  TIGD5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008360	regulation of cell shape	IBA	biological process
GO:0030048	actin filament-based movement	IBA	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0005884	actin filament	IBA	cellular component
GO:0006897	endocytosis	IBA	biological process
GO:0051127	positive regulation of actin nucleation	IBA	biological process
GO:0051666	actin cortical patch localization	IBA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq