• Gene id: 84938

Gene Summary

• Gene Symbol: ATG4C   Gene   UCSC   Ensembl
• Aliases: APG4-C, APG4C, AUTL1, AUTL3
• Gene name: autophagy related 4C cysteine peptidase
• Alternate names: cysteine protease ATG4C, APG4 autophagy 4 homolog C, ATG4 autophagy related 4 homolog C, AUT-like 1, cysteine endopeptidase, AUT-like 3 cysteine endopeptidase, autophagin-3, autophagy-related cysteine endopeptidase 3, autophagy-related protein 4 homolog C, epidid,
• Gene location: 1p31.3 (62783764: 62865515)     Exons: 14     NC_000001.11
• Gene summary(Entrez): Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, a
• OMIM: 603710

Protein Summary

• Protein general information: Q96DT6  
  • Name: Cysteine protease ATG4C (EC 3.4.22. ) (AUT like 3 cysteine endopeptidase) (Autophagin 3) (Autophagy related cysteine endopeptidase 3) (Autophagy related protein 4 homolog C)
  • Length: 458  
  • Mass: 52497
  • Tissue specificity: Highly expressed in skeletal muscle, heart, liver and testis. {ECO
• Sequence:

  MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDHVIAGN
  VEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALNIENSDSESWT
  SHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKSG
  KKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMTSDNADDKAVIILVPVRLGGE
  RTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFVDVSIKDFPLETFHCPSPKKMSF
  RKMDPSCTIGFYCRNVQDFKRASEEITKMLKFSSKEKYPLFTFVNGHSRDYDFTSTTTNEEDLFSEDEKKQLKRF
  STEEFVLL

• Structural information:
  • Interpro: IPR032915  IPR038765  IPR005078  
  • STRING: ENSP00000322159
• Other Databases: GeneCards:  ATG4C  Malacards:  ATG4C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IEA	biological process
GO:0004197	cysteine-type endopeptidase activity	IEA	molecular function
GO:0006914	autophagy	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008234	cysteine-type peptidase activity	IDA	molecular function
GO:0006508	proteolysis	IDA	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0004197	cysteine-type endopeptidase activity	IEA	molecular function
GO:0006914	autophagy	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008234	cysteine-type peptidase activity	IDA	molecular function
GO:0006508	proteolysis	IDA	biological process
GO:0005575	cellular_component	ND	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04140	Autophagy - animal
hsa04136	Autophagy - other

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq