• Gene id: 84934

Gene Summary

• Gene Symbol: RITA1   Gene   UCSC   Ensembl
• Aliases: C12orf52, RITA
• Gene name: RBPJ interacting and tubulin associated 1
• Alternate names: RBPJ-interacting and tubulin-associated protein 1,
• Gene location: 12q24.13 (113185525: 113192367)     Exons: 4     NC_000012.12
• OMIM: 0

Protein Summary

• Protein general information: Q96K30  
  • Name: RBPJ interacting and tubulin associated protein 1 (RBPJ interacting and tubulin associated protein)
  • Length: 269  
  • Mass: 28619
• Sequence:

  MKTPVELAVSGMQTLGLQHRCRGGYRVKARTSYVDETLFGSPAGTRPTPPDFDPPWVEKANRTRGVGKEASKALG
  AKGSCETTPSRGSTPTLTPRKKNKYRPISHTPSYCDESLFGSRSEGASFGAPRMAKGDAAKLRALLWTPPPTPRG
  SHSPRPREAPLRAIHPAGPSKTEPGPAADSQKLSMGGLHSSRPLKRGLSHSLTHLNVPSTGHPATSAPHTNGPQD
  LRPSTSGVTFRSPLVTSRARSVSISVPSTPRRGGATQKPKPPWK

• Structural information:
  • Interpro: IPR031418  
  • PDB: 5EG6
  • PDBsum: 5EG6
  • STRING: ENSP00000448680
• Other Databases: GeneCards:  RITA1  Malacards:  RITA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051168	nuclear export	IBA	biological process
GO:0045746	negative regulation of Notch signaling pathway	IBA	biological process
GO:0015631	tubulin binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0051168	nuclear export	IDA	biological process
GO:0045746	negative regulation of Notch signaling pathway	IDA	biological process
GO:0015631	tubulin binding	IDA	molecular function
GO:0005813	centrosome	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0022008	neurogenesis	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	TAS	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0015631	tubulin binding	IEA	molecular function
GO:0051168	nuclear export	IEA	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881