• Gene id: 84920

Gene Summary

• Gene Symbol: ALG10   Gene   UCSC   Ensembl
• Aliases: ALG10A, DIE2, KCR1
• Gene name: ALG10 alpha-1,2-glucosyltransferase
• Alternate names: dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase, alpha-1,2-glucosyltransferase ALG10-A, alpha-2-glucosyltransferase ALG10-A, alpha2-glucosyltransferase, asparagine-linked glycosylation 10 homolog (yeast, alpha-1,2-glucosyltransferase), asp,
• Gene location: 12p11.1 (120580169: 120388868)     Exons: 39     NC_000009.12
• Gene summary(Entrez): This gene encodes a membrane-associated protein that adds the third glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation. That is, it transfers the terminal glucose from dolichyl phosphate glucose (Dol-P-Glc) onto the l
• OMIM: 618355

Protein Summary

• Protein general information: Q5BKT4  
  • Name: Dol P Glc:Glc(2)Man(9)GlcNAc(2) PP Dol alpha 1,2 glucosyltransferase (EC 2.4.1.256) (Alpha 1,2 glucosyltransferase ALG10 A) (Alpha 2 glucosyltransferase ALG10 A) (Asparagine linked glycosylation protein 10 homolog A)
  • Length: 473  
  • Mass: 55606
• Sequence:

  MAQLEGYYFSAALSCTFLVSCLLFSAFSRALREPYMDEIFHLPQAQRYCEGHFSLSQWDPMITTLPGLYLVSIGV
  IKPAIWIFGWSEHVVCSIGMLRFVNLLFSVGNFYLLYLLFCKVQPRNKAASSIQRVLSTLTLAVFPTLYFFNFLY
  YTEAGSMFFTLFAYLMCLYGNHKTSAFLGFCGFMFRQTNIIWAVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKG
  PFAEFRKILQFLLAYSMSFKNLSMLLLLTWPYILLGFLFCAFVVVNGGIVIGDRSSHEACLHFPQLFYFFSFTLF
  FSFPHLLSPSKIKTFLSLVWKRRILFFVVTLVSVFLVWKFTYAHKYLLADNRHYTFYVWKRVFQRYETVKYLLVP
  AYIFAGWSIADSLKSKSIFWNLMFFICLFTVIVPQKLLEFRYFILPYVIYRLNIPLPPTSRLICELSCYAVVNFI
  TFFIFLNKTFQWPNSQDIQRFMW

• Structural information:
  • Interpro: IPR016900  
  • STRING: ENSP00000266483
• Other Databases: GeneCards:  ALG10  Malacards:  ALG10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0106073	dolichyl pyrophosphate Glc2Man9GlcNAc2 alpha-1,2-glucosyltransferase activity	IBA	molecular function
GO:0006487	protein N-linked glycosylation	IBA	biological process
GO:0006488	dolichol-linked oligosaccharide biosynthetic process	IEA	biological process
GO:0106073	dolichyl pyrophosphate Glc2Man9GlcNAc2 alpha-1,2-glucosyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0106073	dolichyl pyrophosphate Glc2Man9GlcNAc2 alpha-1,2-glucosyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00510	N-Glycan biosynthesis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)