• Gene id: 84901

Gene Summary

• Gene Symbol: NFATC2IP   Gene   UCSC   Ensembl
• Aliases: ESC2, NIP45, RAD60
• Gene name: nuclear factor of activated T cells 2 interacting protein
• Alternate names: NFATC2-interacting protein, 45 kDa NF-AT-interacting protein, 45 kDa NFAT-interacting protein, nuclear factor of activated T-cells, cytoplasmic 2-interacting protein, nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protei,
• Gene location: 16p11.2 (28950991: 28966464)     Exons: 3     NC_000016.10
• OMIM: 614525

Protein Summary

• Protein general information: Q8NCF5  
  • Name: NFATC2 interacting protein (45 kDa NF AT interacting protein) (45 kDa NFAT interacting protein) (Nuclear factor of activated T cells, cytoplasmic 2 interacting protein)
  • Length: 419  
  • Mass: 45817
• Sequence:

  MAEPVGKRGRWSGGSGAGRGGRGGWGGRGRRPRAQRSPSRGTLDVVSVDLVTDSDEEILEVATARGAADEVEVEP
  PEPPGPVASRDNSNSDSEGEDRRPAGPPREPVRRRRRLVLDPGEAPLVPVYSGKVKSSLRLIPDDLSLLKLYPPG
  DEEEAELADSSGLYHEGSPSPGSPWKTKLRTKDKEEKKKTEFLDLDNSPLSPPSPRTKSRTHTRALKKLSEVNKR
  LQDLRSCLSPKPPQGQEQQGQEDEVVLVEGPTLPETPRLFPLKIRCRADLVRLPLRMSEPLQSVVDHMATHLGVS
  PSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLM
  SHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG

• Structural information:
  • Protein Domains: (348..41-)
    (/note="Ubiquitin-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00214"-)
  • Interpro: IPR022617  IPR000626  IPR029071  
  • Prosite: PS50053
  • PDB: 2JXX 2L76 3RD2
  • PDBsum: 2JXX 2L76 3RD2
  • STRING: ENSP00000324792
• Other Databases: GeneCards:  NFATC2IP  Malacards:  NFATC2IP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001816	cytokine production	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0001816	cytokine production	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)