• Gene id: 8490

Gene Summary

• Gene Symbol: RGS5   Gene   UCSC   Ensembl
• Aliases: MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, MSTP129
• Gene name: regulator of G protein signaling 5
• Alternate names: regulator of G-protein signaling 5,
• Gene location: 1q23.3 (163321790: 163142298)     Exons: 9     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the regulators of G protein signaling (RGS) family. The RGS proteins are signal transduction molecules which are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators. This gene is a hypoxia-i
• OMIM: 603276

Protein Summary

• Protein general information: O15539  
  • Name: Regulator of G protein signaling 5 (RGS5)
  • Length: 181  
  • Mass: 20946
• Sequence:

  MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGL
  ASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSS
  FDMAQKRIHALMEKDSLPRFVRSEFYQELIK

• Structural information:
  • Protein Domains: (64..18-)
    (/note="RGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00171"-)
  • Interpro: IPR016137  IPR034955  IPR034956  IPR036305  IPR024066  
  • Prosite: PS50132
  • CDD: cd08717
  • PDB: 2CRP
  • PDBsum: 2CRP
  • STRING: ENSP00000433001
• Other Databases: GeneCards:  RGS5  Malacards:  RGS5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005096	GTPase activator activity	TAS	molecular function
GO:0008277	regulation of G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0003924	GTPase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881