• Gene id: 84894

Gene Summary

• Gene Symbol: LINGO1   Gene   UCSC   Ensembl
• Aliases: LERN1, LRRN6A, MRT64, UNQ201
• Gene name: leucine rich repeat and Ig domain containing 1
• Alternate names: leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1, leucine rich repeat neuronal 6A, leucine-rich repeat and immunoglobulin domain-containing protein 1, leucine-rich repeat neuronal protein 1,
• Gene location: 15q24.3 (77820899: 77613023)     Exons: 17     NC_000015.10

Protein Summary

• Protein general information: Q96FE5  
  • Name: Leucine rich repeat and immunoglobulin like domain containing nogo receptor interacting protein 1 (Leucine rich repeat and immunoglobulin domain containing protein 1) (Leucine rich repeat neuronal protein 1) (Leucine rich repeat neuronal protein 6A)
  • Length: 620  
  • Mass: 69876
  • Tissue specificity: Expressed exclusively in the central nervous system. Highest level in the in amygdala, hippocampus, thalamus and cerebral cortex. In the rest of the brain a basal expression seems to be always present. Up-regulated in substantia nigra
• Sequence:

  MQVSKRMLAGGVRSMPSPLLACWQPILLLVLGSVLSGSATGCPPRCECSAQDRAVLCHRKRFVAVPEGIPTETRL
  LDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKLIPLGVFTGLSNLTKLDI
  SENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHL
  NINAIRDYSFKRLYRLKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPIS
  TIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVLNVSGNQLTTLEESVFHSVGNLETLILDSNPLACDC
  RLLWVFRRRWRLNFNRQQPTCATPEFVQGKEFKDFPDVLLPNYFTCRRARIRDRKAQQVFVDEGHTVQFVCRADG
  DPPPAILWLSPRKHLVSAKSNGRLTVFPDGTLEVRYAQVQDNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPHQP
  NKTFAFISNQPGEGEANSTRATVPFPFDIKTLIIATTMGFISFLGVVLFCLVLLFLWSRGKGNTKHNIEIEYVPR
  KSDAGISSADAPRKFNMKMI

• Structural information:
  • Protein Domains: (42..7-)
    (/note="LRRNT-)
    (369..42-)
    (/note="LRRCT-)
    (411..51-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013098  IPR003599   IPR003598  IPR001611  IPR003591  IPR026906  IPR032675  IPR000372  
  • Prosite: PS50835 PS51450
  • PDB: 2ID5 4OQT
  • PDBsum: 2ID5 4OQT
  • DIP: 60981
  • STRING: ENSP00000347451
• Other Databases: GeneCards:  LINGO1  Malacards:  LINGO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005154	epidermal growth factor receptor binding	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0031012	extracellular matrix	IBA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050771	negative regulation of axonogenesis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Glaucoma	PMID:19422885
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq