• Gene id: 84890

Gene Summary

• Gene Symbol: ADO   Gene   UCSC   Ensembl
• Aliases: C10orf22
• Gene name: 2-aminoethanethiol dioxygenase
• Alternate names: 2-aminoethanethiol dioxygenase, 2-aminoethanethiol (cysteamine) dioxygenase, cysteamine (2-aminoethanethiol) dioxygenase (ADO), cysteamine dioxygenase,
• Gene location: 10q21.3 (62804719: 62808478)     Exons: 1     NC_000010.11
• Gene summary(Entrez): Human thiol dioxygenases include cysteine dioxygenase (CDO; MIM 603943) and cysteamine (2-aminoethanethiol) dioxygenase (ADO; EC 1.13.11.19). CDO adds 2 oxygen atoms to free cysteine, whereas ADO adds 2 oxygen atoms to free cysteamine to form hypotaurine
• OMIM: 611392

Protein Summary

• Protein general information: Q96SZ5  
  • Name: 2 aminoethanethiol dioxygenase (EC 1.13.11.19) (Cysteamine dioxygenase)
  • Length: 270  
  • Mass: 29751
• Sequence:

  MPRDNMASLIQRIARQACLTFRGSGGGRGASDRDAASGPEAPMQPGFPENLSKLKSLLTQLRAEDLNIAPRKATL
  QPLPPNLPPVTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGMLKVLYGTVRISCMDKLDAGGGQRPRALPPE
  QQFEPPLQPREREAVRPGVLRSRAEYTEASGPCILTPHRDNLHQIDAVEGPAAFLDILAPPYDPDDGRDCHYYRV
  LEPVRPKEASSSACDLPREVWLLETPQADDFWCEGEPYPGPKVFP

• Structural information:
  • Interpro: IPR012864  IPR011051  
  • STRING: ENSP00000362888
• Other Databases: GeneCards:  ADO  Malacards:  ADO

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016702	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0051213	dioxygenase activity	IEA	molecular function
GO:0047800	cysteamine dioxygenase activity	IEA	molecular function
GO:0000098	sulfur amino acid catabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00430	Taurine and hypotaurine metabolism

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray