• Gene id: 84889

Gene Summary

• Gene Symbol: SLC7A3   Gene   UCSC   Ensembl
• Aliases: ATRC3, CAT-3, CAT3
• Gene name: solute carrier family 7 member 3
• Alternate names: cationic amino acid transporter 3, solute carrier family 7 (cationic amino acid transporter, y+ system), member 3,
• Gene location: Xq13.1 (49628455: 49633871)     Exons: 3     NC_000013.11
• Gene summary(Entrez): This gene encodes a member of the solute carrier family 7. The encoded protein is a sodium-independent cationic amino acid transporter. Alternate splicing results in multiple transcripts that encoded the same protein.[provided by RefSeq, May 2010]
• OMIM: 300443

Protein Summary

• Protein general information: Q8WY07  
  • Name: Cationic amino acid transporter 3 (CAT 3) (CAT3) (Cationic amino acid transporter y+) (Solute carrier family 7 member 3)
  • Length: 619  
  • Mass: 67169
  • Tissue specificity: Highly expressed in thymus, uterus and testis. Detected at lower levels in brain, mammary gland, prostate, salivary gland and fetal spleen. In brain, highest expression in thalamus, hippocampus and amygdala. {ECO
• Sequence:

  MPWQAFRRFGQKLVRRRTLESGMAETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKDKAGPSIVICFLVAAL
  SSVLAGLCYAEFGARVPRSGSAYLYSYVTVGELWAFTTGWNLILSYVIGTASVARAWSSAFDNLIGNHISKTLQG
  SIALHVPHVLAEYPDFFALGLVLLLTGLLALGASESALVTKVFTGVNLLVLGFVMISGFVKGDVHNWKLTEEDYE
  LAMAELNDTYSLGPLGSGGFVPFGFEGILRGAATCFYAFVGFDCIATTGEEAQNPQRSIPMGIVISLSVCFLAYF
  AVSSALTLMMPYYQLQPESPLPEAFLYIGWAPARYVVAVGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFRVLAR
  IHTGTRTPIIATVVSGIIAAFMAFLFKLTDLVDLMSIGTLLAYSLVSICVLILRYQPDQETKTGEEVELQEEAIT
  TESEKLTLWGLFFPLNSIPTPLSGQIVYVCSSLLAVLLTALCLVLAQWSVPLLSGDLLWTAVVVLLLLLIIGIIV
  VIWRQPQSSTPLHFKVPALPLLPLMSIFVNIYLMMQMTAGTWARFGVWMLIGFAIYFGYGIQHSLEEIKSNQPSR
  KSRAKTVDLDPGTLYVHSV

• Structural information:
  • Interpro: IPR002293  IPR015606  IPR004755  IPR029485  
  • STRING: ENSP00000363417
• Other Databases: GeneCards:  SLC7A3  Malacards:  SLC7A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097639	L-lysine import across plasma membrane	IDA	biological process
GO:0097638	L-arginine import across plasma membrane	IDA	biological process
GO:0000064	L-ornithine transmembrane transporter activity	IDA	molecular function
GO:0097640	L-ornithine import across plasma membrane	IDA	biological process
GO:0061459	L-arginine transmembrane transporter activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0015189	L-lysine transmembrane transporter activity	IDA	molecular function
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:1903352	L-ornithine transmembrane transport	IBA	biological process
GO:0015189	L-lysine transmembrane transporter activity	IBA	molecular function
GO:0015181	arginine transmembrane transporter activity	IBA	molecular function
GO:0006865	amino acid transport	IBA	biological process
GO:0097638	L-arginine import across plasma membrane	IBA	biological process
GO:0015171	amino acid transmembrane transporter activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0000064	L-ornithine transmembrane transporter activity	IBA	molecular function
GO:0006865	amino acid transport	IEA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:1902475	L-alpha-amino acid transmembrane transport	IEA	biological process
GO:0006865	amino acid transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0015171	amino acid transmembrane transporter activity	TAS	molecular function
GO:0006865	amino acid transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0015809	arginine transport	IEA	biological process
GO:0015174	basic amino acid transmembrane transporter activity	IEA	molecular function
GO:0015189	L-lysine transmembrane transporter activity	IEA	molecular function
GO:0015181	arginine transmembrane transporter activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:1903401	L-lysine transmembrane transport	IEA	biological process
GO:1903401	L-lysine transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)