• Gene id: 84875

Gene Summary

• Gene Symbol: PARP10   Gene   UCSC   Ensembl
• Aliases: ARTD10
• Gene name: poly(ADP-ribose) polymerase family member 10
• Alternate names: protein mono-ADP-ribosyltransferase PARP10, ADP-ribosyltransferase diphtheria toxin-like 10, poly [ADP-ribose] polymerase 10,
• Gene location: 8q24.3 (143986459: 143977157)     Exons: 11     NC_000008.11
• Gene summary(Entrez): Poly(ADP-ribose) polymerases (PARPs), such as PARP10, regulate gene transcription by altering chromatin organization by adding ADP-ribose to histones. PARPs can also function as transcriptional cofactors (Yu et al., 2005 [PubMed 15674325]).[supplied by OM

Protein Summary

• Protein general information: Q53GL7  
  • Name: Protein mono ADP ribosyltransferase PARP10 (EC 2.4.2. ) (ADP ribosyltransferase diphtheria toxin like 10) (ARTD10) (Poly [ADP ribose] polymerase 10) (PARP 10)
  • Length: 1025  
  • Mass: 109998
  • Tissue specificity: Highly expressed in spleen and thymus (PubMed
• Sequence:

  MVAMAEAEAGVAVEVRGLPPAVPDELLTLYFENRRRSGGGPVLSWQRLGCGGVLTFREPADAERVLAQADHELHG
  AQLSLRPAPPRAPARLLLQGLPPGTTPQRLEQHVQALLRASGLPVQPCCALASPRPDRALVQLPKPLSEADVRVL
  EEQAQNLGLEGTLVSLARVPQARAVRVVGDGASVDLLLLELYLENERRSGGGPLEDLQRLPGPLGTVASFQQWQV
  AERVLQQEHRLQGSELSLVPHYDILEPEELAENTSGGDHPSTQGPRATKHALLRTGGLVTALQGAGTVTMGSGEE
  PGQSGASLRTGPMVQGRGIMTTGSGQEPGQSGTSLRTGPMGSLGQAEQVSSMPMGSLEHEGLVSLRPVGLQEQEG
  PMSLGPVGSAGPVETSKGLLGQEGLVEIAMDSPEQEGLVGPMEITMGSLEKAGPVSPGCVKLAGQEGLVEMVLLM
  EPGAMRFLQLYHEDLLAGLGDVALLPLEGPDMTGFRLCGAQASCQAAEEFLRSLLGSISCHVLCLEHPGSARFLL
  GPEGQHLLQGLEAQFQCVFGTERLATATLDTGLEEVDPTEALPVLPGNAHTLWTPDSTGGDQEDVSLEEVRELLA
  TLEGLDLDGEDWLPRELEEEGPQEQPEEEVTPGHEEEEPVAPSTVAPRWLEEEAALQLALHRSLEPQGQVAEQEE
  AAALRQALTLSLLEQPPLEAEEPPDGGTDGKAQLVVHSAFEQDVEELDRALRAALEVHVQEETVGPWRRTLPAEL
  RARLERCHGVSVALRGDCTILRGFGAHPARAARHLVALLAGPWDQSLAFPLAASGPTLAGQTLKGPWNNLERLAE
  NTGEFQEVVRAFYDTLDAARSSIRVVRVERVSHPLLQQQYELYRERLLQRCERRPVEQVLYHGTTAPAVPDICAH
  GFNRSFCGRNATVYGKGVYFARRASLSVQDRYSPPNADGHKAVFVARVLTGDYGQGRRGLRAPPLRGPGHVLLRY
  DSAVDCICQPSIFVIFHDTQALPTHLITCEHVPRASPDDPSGLPGRSPDT

• Structural information:
  • Protein Domains: (806..102-)
    (/note="PARP-catalytic)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00397"-)
  • Interpro: IPR012677  IPR034464  IPR012317  
  • Prosite: PS51059
  • CDD: cd12547
  • PDB: 2DHX 3HKV 5LX6 6FXI
  • PDBsum: 2DHX 3HKV 5LX6 6FXI
  • STRING: ENSP00000325618
• Other Databases: GeneCards:  PARP10  Malacards:  PARP10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990404	protein ADP-ribosylase activity	IBA	molecular function
GO:0140289	protein mono-ADP-ribosylation	IBA	biological process
GO:0070212	protein poly-ADP-ribosylation	IBA	biological process
GO:0010629	negative regulation of gene expression	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003950	NAD+ ADP-ribosyltransferase activity	IBA	molecular function
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0019985	translesion synthesis	IDA	biological process
GO:0140289	protein mono-ADP-ribosylation	IDA	biological process
GO:1990404	protein ADP-ribosylase activity	IDA	molecular function
GO:0140289	protein mono-ADP-ribosylation	IDA	biological process
GO:1990404	protein ADP-ribosylase activity	IDA	molecular function
GO:0070213	protein auto-ADP-ribosylation	IDA	biological process
GO:0070213	protein auto-ADP-ribosylation	IDA	biological process
GO:1990404	protein ADP-ribosylase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003950	NAD+ ADP-ribosyltransferase activity	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0034356	NAD biosynthesis via nicotinamide riboside salvage pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:1903507	negative regulation of nucleic acid-templated transcription	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0070212	protein poly-ADP-ribosylation	IDA	biological process
GO:0048147	negative regulation of fibroblast proliferation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0010847	regulation of chromatin assembly	IDA	biological process
GO:0045071	negative regulation of viral genome replication	IMP	biological process
GO:0006471	protein ADP-ribosylation	IMP	biological process
GO:1900045	negative regulation of protein K63-linked ubiquitination	IMP	biological process
GO:0070530	K63-linked polyubiquitin modification-dependent protein binding	IMP	molecular function
GO:0070213	protein auto-ADP-ribosylation	IMP	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0003950	NAD+ ADP-ribosyltransferase activity	IMP	molecular function
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003950	NAD+ ADP-ribosyltransferase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070212	protein poly-ADP-ribosylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq