• Gene id: 84871

Gene Summary

• Gene Symbol: AGBL4   Gene   UCSC   Ensembl
• Aliases: CCP6
• Gene name: ATP/GTP binding protein like 4
• Alternate names: cytosolic carboxypeptidase 6,
• Gene location: 1p33 (50023953: 48520156)     Exons: 20     NC_000001.11
• OMIM: 616476

Protein Summary

• Protein general information: Q5VU57  
  • Name: Cytosolic carboxypeptidase 6 (EC 3.4.17. ) (ATP/GTP binding protein like 4)
  • Length: 503  
  • Mass: 58230
• Sequence:

  MAEGSQSAPEAGNDMGNDDAIGGNVSKYIVLPTGYCGQPKKGHLIFDACFESGNLGRVDQVSEFEYDLFIRPDTC
  NPRFRVWFNFTVENVKESQRVIFNIVNFSKTKSLYRDGMAPMVKSTSRPKWQRLPPKNVYYYRCPDHRKNYVMSF
  AFCFDREEDIYQFAYCYPYTYTRFQHYLDSLQKRNMDYFFREQLGQSVQQRKLDLLTITSPDNLREGAEQKVVFI
  TGRVHPGETPSSFVCQGIIDFLVSQHPIACVLREYLVFKIAPMLNPDGVYLGNYRCSLMGFDLNRHWLDPSPWVH
  PTLHGVKQLIVQMYNDPKTSLEFYIDIHAHSTMMNGFMYGNIFEDEERFQRQAIFPKLLCQNAEDFSYSSTSFNR
  DAVKAGTGRRFLGGLLDHTSYCYTLEVSFYSYIISGTTAAVPYTEEAYMKLGRNVARTFLDYYRLNPVVEKVAIP
  MPRLRNKEIEVQRRKEKSPPYKHPLLRGPASNYPNSKGDKKSSVNHKDPSTPF

• Structural information:
  • Interpro: IPR040626  IPR000834  
  • STRING: ENSP00000360905
• Other Databases: GeneCards:  AGBL4  Malacards:  AGBL4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035608	protein deglutamylation	IBA	biological process
GO:0035609	C-terminal protein deglutamylation	IBA	biological process
GO:0035610	protein side chain deglutamylation	IBA	biological process
GO:0004181	metallocarboxypeptidase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0036064	ciliary basal body	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005814	centriole	IDA	cellular component
GO:0015631	tubulin binding	ISS	molecular function
GO:0005829	cytosol	ISS	cellular component
GO:0004181	metallocarboxypeptidase activity	ISS	molecular function
GO:0051607	defense response to virus	ISS	biological process
GO:0035610	protein side chain deglutamylation	ISS	biological process
GO:0035609	C-terminal protein deglutamylation	ISS	biological process
GO:0035608	protein deglutamylation	ISS	biological process
GO:0004181	metallocarboxypeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0098957	anterograde axonal transport of mitochondrion	IEA	biological process
GO:0098930	axonal transport	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0015631	tubulin binding	IEA	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0004181	metallocarboxypeptidase activity	IEA	molecular function
GO:2000060	positive regulation of ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0098958	retrograde axonal transport of mitochondrion	IEA	biological process
GO:0035610	protein side chain deglutamylation	IEA	biological process
GO:0035609	C-terminal protein deglutamylation	IEA	biological process
GO:0035608	protein deglutamylation	IEA	biological process
GO:0021954	central nervous system neuron development	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005814	centriole	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:0030424	axon	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray