• Gene id: 84869

Gene Summary

• Gene Symbol: CBR4   Gene   UCSC   Ensembl
• Aliases: SDR45C1
• Gene name: carbonyl reductase 4
• Alternate names: carbonyl reductase family member 4, 3-ketoacyl-[acyl-carrier-protein] reductase beta subunit, 3-oxoacyl-[acyl-carrier-protein] reductase, KAR beta subunit, carbonic reductase 4, quinone reductase CBR4, short chain dehydrogenase/reductase family 45C member 1,
• Gene location: 4q32.3 (161197416: 161214394)     Exons: 15     NC_000001.11

Protein Summary

• Protein general information: Q8N4T8  
  • Name: Carbonyl reductase family member 4 (EC 1. . . ) (3 ketoacyl [acyl carrier protein] reductase beta subunit) (KAR beta subunit) (3 oxoacyl [acyl carrier protein] reductase) (EC 1.1.1. ) (Quinone reductase CBR4) (Short chain dehydrogenase/reductase family 45
  • Length: 237  
  • Mass: 25301
  • Tissue specificity: Detected in liver and kidney (at protein level). {ECO
• Sequence:

  MDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLG
  RVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSA
  SKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGH
  VLVVDGGLQLIL

• Structural information:
  • Interpro: IPR036291  IPR020904  IPR002347  
  • Prosite: PS00061
  • PDB: 4CQL 4CQM
  • PDBsum: 4CQL 4CQM
  • STRING: ENSP00000303525
• Other Databases: GeneCards:  CBR4  Malacards:  CBR4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006633	fatty acid biosynthetic process	IBA	biological process
GO:0048038	quinone binding	IBA	molecular function
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IBA	molecular function
GO:0051289	protein homotetramerization	IDA	biological process
GO:0048038	quinone binding	IDA	molecular function
GO:0008753	NADPH dehydrogenase (quinone) activity	IDA	molecular function
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0070402	NADPH binding	IDA	molecular function
GO:0005759	mitochondrial matrix	IDA	cellular component
GO:0051290	protein heterotetramerization	IDA	biological process
GO:0070402	NADPH binding	IDA	molecular function
GO:0006633	fatty acid biosynthetic process	IMP	biological process
GO:1990204	oxidoreductase complex	IMP	cellular component
GO:0047025	3-oxoacyl-[acyl-carrier-protein] reductase (NADH) activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0046949	fatty-acyl-CoA biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0003955	NAD(P)H dehydrogenase (quinone) activity	IDA	molecular function
GO:0044597	daunorubicin metabolic process	IMP	biological process
GO:0044598	doxorubicin metabolic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01212	Fatty acid metabolism
hsa00061	Fatty acid biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray