• Gene id: 84867

Gene Summary

• Gene Symbol: PTPN5   Gene   UCSC   Ensembl
• Aliases: PTPSTEP, STEP, STEP61
• Gene name: protein tyrosine phosphatase non-receptor type 5
• Alternate names: tyrosine-protein phosphatase non-receptor type 5, neural-specific protein-tyrosine phosphatase, protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched), protein-tyrosine phosphatase striatum-enriched, striatal-enriched protein tyrosine phosphata,
• Gene location: 11p15.1 (18792720: 18727927)     Exons: 16     NC_000011.10
• OMIM: 604624

Protein Summary

• Protein general information: P54829  
  • Name: Tyrosine protein phosphatase non receptor type 5 (EC 3.1.3.48) (Neural specific protein tyrosine phosphatase) (Striatum enriched protein tyrosine phosphatase) (STEP)
  • Length: 565  
  • Mass: 63538
• Sequence:

  MNYEGARSERENHAADDSEGGALDMCCSERLPGLPQPIVMEALDEAEGLQDSQREMPPPPPPSPPSDPAQKPPPR
  GAGSHSLTVRSSLCLFAASQFLLACGVLWFSGYGHIWSQNATNLVSSLLTLLKQLEPTAWLDSGTWGVPSLLLVF
  LSVGLVLVTTLVWHLLRTPPEPPTPLPPEDRRQSVSRQPSFTYSEWMEEKIEDDFLDLDPVPETPVFDCVMDIKP
  EADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLSASRVLQAEELHEKALDPFLL
  QAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGP
  IVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERG
  LKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDIL
  KTTCQLRQDRGGMIQTCEQYQFVHHVMSLYEKQLSHQSPE

• Structural information:
  • Protein Domains: (300..55-)
    (/note="Tyrosine-protein-phosphatase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00160"-)
  • Interpro: IPR029021  IPR000242  IPR016130  IPR003595  IPR008356   IPR016334  IPR000387  
  • Prosite: PS00383 PS50056 PS50055
  • PDB: 2BIJ 2BV5 2CJZ 5OVR 5OVX 5OW1 6H8R
  • PDBsum: 2BIJ 2BV5 2CJZ 5OVR 5OVX 5OW1 6H8R
  • STRING: ENSP00000351342
• Other Databases: GeneCards:  PTPN5  Malacards:  PTPN5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001784	phosphotyrosine residue binding	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016791	phosphatase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0071345	cellular response to cytokine stimulus	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	TAS	biological process
GO:0004725	protein tyrosine phosphatase activity	TAS	molecular function
GO:0016021	integral component of membrane	TAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway

Diseases

Associated diseases	References
Alzheimer's disease	PMID:20427654
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq