• Gene id: 84866

Gene Summary

• Gene Symbol: TMEM25   Gene   UCSC   Ensembl
• Gene name: transmembrane protein 25
• Alternate names: transmembrane protein 25, 0610039J01Rik,
• Gene location: 11q23.3 (118531087: 118546597)     Exons: 10     NC_000011.10
• OMIM: 604840

Protein Summary

• Protein general information: Q86YD3  
  • Name: Transmembrane protein 25
  • Length: 366  
  • Mass: 39285
  • Tissue specificity: Expressed throughout the brain with higher levels in the pyramidal cell layer of the hippocampal CA1 and CA3 regions. Also highly expressed iwhith the hippocampal dentate gyrus region and cerebellum and in scattered neurons in the cere
• Sequence:

  MALPPGPAALRHTLLLLPALLSSGWGELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEAS
  TSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVV
  LFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPG
  LLATRVEVPLLGIVVAAGLALGTLVGFSTLVACLVCRKEKKTKGPSRHPSLISSDSNNLKLNNVRLPRENMSLPS
  NLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVLGYIYRVSSVSSDEIWL

• Structural information:
  • Protein Domains: (30..12-)
    (/note="Ig-like"-)
  • Interpro: IPR013162  IPR007110  IPR036179  IPR013783  IPR042864  
  • Prosite: PS50835
  • STRING: ENSP00000315635
• Other Databases: GeneCards:  TMEM25  Malacards:  TMEM25

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090394	negative regulation of excitatory postsynaptic potential	IBA	biological process
GO:0005764	lysosome	ISS	cellular component
GO:0005770	late endosome	ISS	cellular component
GO:0090394	negative regulation of excitatory postsynaptic potential	ISS	biological process
GO:0031647	regulation of protein stability	ISS	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq